Recombinant Human 5-hydroxytryptamine receptor 3A (HTR3A)

Shipped with Ice Packs
In Stock

Description

Definition and Production

HTR3A is a recombinant protein derived from the HTR3A gene, encoding subunit A of the 5-HT3 receptor. Native 5-HT3 receptors are pentameric complexes formed by HTR3A alone or with subunits HTR3B, HTR3C, HTR3D, or HTR3E . Recombinant HTR3A is produced via heterologous expression systems, including:

  • Baculovirus-Mammalian (BacMam): HEK293F cells transduced with baculoviruses yield 0.5 mg/L of purified HTR3A, tagged with MBP and His tags for affinity purification .

  • E. coli: Cytoplasmic expression with N-terminal His tags enables high-yield production, though solubility challenges require detergent-based refolding .

  • Mammalian Cell Lines: HEK293 or COS-7 cells expressing HTR3A fused with GFP or epitope tags for localization studies .

Production MethodHost SystemTagYieldPurification
BacMamHEK293FMBP + His0.5 mg/LMBP affinity + TEV cleavage
Bacterial ExpressionE. coliN-terminal His>90% purityNi-NTA chromatography
Mammalian TransfectionHEK293GFP/EpitopeVariableImmunoprecipitation

Subunit Assembly and Ion Channel Properties

HTR3A forms homomeric or heteromeric receptors:

  • Homomers: HTR3A alone exhibits low conductance (e.g., Na⁺, K⁺, Ca²⁺ permeability) and rapid desensitization .

  • Heteromers: Co-expression with HTR3B or other subunits enhances ion selectivity, conductance, and pharmacological diversity .

Receptor TypeSubunit CompositionConductanceFunctional Role
Homomeric5x HTR3ALowLimited neuronal signaling
Heteromeric2x HTR3A + 3x HTR3BHighFast synaptic transmission

Anticancer and Neurological Research

ApplicationModel SystemKey FindingsSource
Colorectal CancerHCT116, SW1116 cellsHTR3A silencing induces S-phase arrest and apoptosis .
Irritable Bowel Syndrome (IBS)Rat modelsHTR3A antagonists reduce visceral hypersensitivity .
Psychiatric DisordersFSH-signaling pathwaysHTR3A variants linked to affective disorders .

Alternative Splicing and Isoforms

  • HTR3A(a) and HTR3A(b): Splice variants differ in the M3-M4 loop, altering receptor trafficking and function .

  • Species-Specific Variants: Mouse/rat HTR3A(b) lacks 5–6 amino acids compared to human HTR3A .

Post-Translational Modifications

  • N-Glycosylation: Essential for cell surface trafficking and ligand binding .

  • Phosphorylation: PKA/PKC modulates receptor activity, though direct phosphorylation sites remain unconfirmed .

Disease Associations

  • Colorectal Cancer: HTR3A overexpression promotes cell proliferation; antagonists (e.g., tropisetron) induce apoptosis .

  • Emesis: HTR3A antagonists (e.g., ondansetron) are first-line antiemetics in chemotherapy .

  • Genetic Polymorphisms: HTR3A variants linked to nausea susceptibility and psychiatric disorders .

Diagnostic and Therapeutic Tools

  • Antibodies: Polyclonal anti-HTR3A antibodies (e.g., bs-2126R, 10443-1-AP) enable Western blot, IHC, and flow cytometry .

  • Recombinant Proteins: Used in high-throughput drug screening and structural biology .

Challenges and Future Directions

  • Low Yield in Homomeric Forms: BacMam systems prioritize heteromeric HTR3A/B for functional studies .

  • Cryo-EM Limitations: Native HTR3A lacks sufficient stability for high-resolution structures; engineered variants are under investigation .

  • Cancer Therapy: Targeting HTR3A in CRC requires further validation in vivo .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. We kindly request you to contact your local distributors for specific delivery timeframes.
Note: All of our proteins are standardly shipped with normal blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be finalized during the production process. If you have a preference for a specific tag type, please communicate it to us, and we will prioritize its development.
Synonyms
HTR3A; 5HT3R; HTR3; 5-hydroxytryptamine receptor 3A; 5-HT3-A; 5-HT3A; 5-hydroxytryptamine receptor 3; 5-HT-3; 5-HT3R; Serotonin receptor 3A; Serotonin-gated ion channel receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-478
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
RRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTTVSIDVIVYAILNVDEKNQVLTTY IWYRQYWTDEFLQWNPEDFDNITKLSIPTDSIWVPDILINEFVDVGKSPNIPYVYIRHQG EVQNYKPLQVVTACSLDIYNFPFDVQNCSLTFTSWLHTIQDINISLWRLPEKVKSDRSVF MNQGEWELLGVLPYFREFSMESSNYYAEMKFYVVIRRRPLFYVVSLLLPSIFLMVMDIVG FYLPPNSGERVSFKITLLLGYSVFLIIVSDTLPATAIGTPLIGVYFVVCMALLVISLAET IFIVRLVHKQDLQQPVPAWLRHLVLERIAWLLCLREQSTSQRPPATSQATKTDDCSAMGN HCSHMGGPQDFEKSPRDRCSPPPPPREASLAVCGLLQELSSIRQFLEKRDEIREVARDWL RVGSVLDKLLFHIYLLAVLAYSITLVMLWSIWQYA
Uniprot No.

Target Background

Function
The 5-hydroxytryptamine receptor 3A (HTR3A) is one of several receptors for 5-hydroxytryptamine (serotonin), a vital biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor acts as a ligand-gated ion channel, which, upon activation, triggers rapid, depolarizing responses in neurons. It is a cation-specific, but otherwise relatively nonselective, ion channel.
Gene References Into Functions
  1. This research demonstrated that the C and E subunits, when assembled as simple or complex heteromeric 5-HT3 receptors, can potentially alter the efficacy of serotonin and clinically used antagonists. PMID: 29793334
  2. Methylation status of the HTR3A gene in mothers is linked to maternal violence-related psychopathology, trauma-induced brain activation patterns, and child attachment disturbance during a crucial developmental period for self-regulation. PMID: 27720744
  3. This study did not find a significant role for HTR3A in predicting Antipsychotic-Induced Weight Gain. PMID: 28531893
  4. Methylation pattern changes in the 5-HTR3A gene have been associated with suicidal behavior in individuals with borderline personality disorder, bipolar disorder, and attention deficit/hyperactivity disorder (ADHD). PMID: 28470485
  5. Findings suggest a positive correlation between HTR3A mRNA expression levels and craving in Han Chinese alcohol-dependent patients. PMID: 27144979
  6. This study provides structural data revealing the orientation of palonosetron within a 5-HT3 receptor binding site mimic. Combined with functional data in the 5-HT3 receptor, these findings explain the high affinity and prolonged actions of this compound. These are likely due to specific interactions formed with binding site residues, and its location as a tight and effective wedge in the binding pocket. PMID: 27656911
  7. Research has shown that 5-HT3 receptors modulate the activity of vascular and non-vascular smooth muscles. PMID: 27720614
  8. The HTR3A rs1062613 polymorphisms do not appear to directly influence experimental muscle pain in healthy individuals. However, women reported higher pain intensity and larger pain area than men, which might be partly attributed to genotype. PMID: 28002447
  9. Studies with 16 arylguanidines have shown that their functional activity spans a broad spectrum from superagonist to full agonist, partial agonist, and antagonist at 5-HT3 receptors. These results confirm the utility of phenylguanidine as a versatile scaffold in the design of 5-HT3 ligands with tunable levels of agonist or antagonist activity. PMID: 27533595
  10. Analysis of a small Chinese sample revealed a significant association of HTR3A with bipolar disorder, but no evidence of an association between HTR3B and bipolar disorder. Furthermore, evidence for an association was found for a haplotype of HTR3A. PMID: 27706728
  11. The serotonin 3A receptor (5-HT3AR) has been linked at both genetic and epigenetic levels to a variety of psychiatric disorders. PMID: 26350166
  12. A gene-environment interaction has been identified between childhood trauma and 5-htr3a polymorphisms. PMID: 26701104
  13. Distal targeting of 5-HT3A receptors in axons and dendrites is dependent on P2X2R expression. PMID: 26843630
  14. Both agonist- and antagonist-induced up-regulation of surface 5-HT3A receptors have been observed. PMID: 25989383
  15. Data indicate that n-alkanols exhibit diverse spectra of effects on serotonin receptor 3A (5-HT3A) receptors, suggesting no two n-alkanols act identically. PMID: 25863270
  16. Our findings support the notion that different haplotypes of HTR3A have reciprocal effects in the etiology of Postoperative nausea. PMID: 25339231
  17. HTR3A gene variants may contribute to variability in severity and response to antiemetic therapy for nausea and vomiting of pregnancy. PMID: 23786674
  18. These data support the role of intracellular salt bridges in maintaining the quaternary structure of the 5-HT3 receptor. They also suggest a role for the intracellular domain in allosteric modulation of cooperativity and agonist efficacy. PMID: 24283776
  19. Considering the role of the 5-hydroxytryptamine 3A subtype receptor in the manifestation of asthma symptoms, increased expression of this receptor may exacerbate the severity of asthma. PMID: 24338226
  20. Data suggest that HTR3A/HTR3B subunits readily form functionally distinct heteromeric receptors. Molecular models have been developed regarding affinities of competitive ligands, non-competitive antagonists, and allosteric modulators. [REVIEW] PMID: 23489111
  21. A significant increase in the relative expression level of 5-HT(3A) receptor has been observed in PBMCs. PMID: 24304330
  22. Variants in HTR3A, HTR3B, and SLC6A4 interactively contribute to the etiology of alcohol, cocaine, and nicotine dependence. PMID: 24590108
  23. Research has focused on the stoichiometry of 5-HT3AB receptors on the plasma membrane. PMID: 23972841
  24. HTR3A, HTR3B, and SLC6A4 exhibit significant interactions among their genes and are highly involved in nicotine dependence. PMID: 23290502
  25. Mutagenic analysis has been conducted on the intracellular portals of the human 5-HT3A receptor. PMID: 24030822
  26. Genetic variability within SLC6A4, HTR3A, and HTR3B contributes to the risk of alcohol dependence and related phenotypes. PMID: 23757001
  27. Data indicate that Arg-436 is critical for the inward rectification of 5-HT3A receptor-mediated macroscopic currents. PMID: 23740249
  28. Polymorphisms in the HTR3A gene have been identified as predictors of reduced alcohol drinking in response to ondansetron. PMID: 23897038
  29. The findings of this study do not support the involvement of the 5-HTR3A gene C178T polymorphism in tardive dyskinesia in Korean schizophrenia subjects. PMID: 23126479
  30. The association between HTR3A gene SNP and response to clozapine is influenced by various clinical predictors and differing outcome definitions in patients with treatment-resistant schizophrenia. PMID: 22700043
  31. HTR3A and HTR3B were detected in all investigated brain tissues except for the cerebellum, and significant variations in the A:B subunit ratio were observed. PMID: 22832903
  32. Rather than involving the 5-HT3-dependent pathway, the negative effect of ondansetron on platelet aggregation is instead manifested through the attenuation of agonist-induced IP3 production and MAPK (p38 and ERK2). PMID: 22818390
  33. This study does not support the hypothesis that the 5-HT(3A) receptor plays a significant role in the pathogenesis of schizophrenia. PMID: 22328445
  34. The CC genotype of TPH2 rs2171363, GG genotype of TPH2 rs7305115, CC genotype of HTR2A rs2770304, and CC genotype of HTR2A rs6313 were associated with reduced internalizing scores for children born in the quartile above the birth weight midpoint. PMID: 21969281
  35. The serotonin receptor 3A c.-42T allele is associated with severe dyspeptic symptoms. The stronger association among dyspeptic patients carrying the serotonin transporter L allele suggests an additive effect of the two polymorphisms. PMID: 22014438
  36. Data show that 5-HTA/bungarotoxin binding sequence (BBS) receptors are constitutively internalized in the absence of an agonist, and both internalization and receptor function are inhibited by fluorescence. PMID: 21338684
  37. This research reports significant correlations of the HTR3A polymorphisms with amygdala responsiveness, anxiety, and irritable bowel syndrome symptom severity. PMID: 21420406
  38. Rings of charge within the extracellular vestibule influence ion permeation of the 5-HT3A receptor. PMID: 21454663
  39. Findings indicate that HTR3A and HTR3B polymorphisms may not play a significant role in the susceptibility to suicidal behavior in schizophrenia subjects. PMID: 21184810
  40. These findings suggest that the HTR3A CC genotype may be associated with alterations in brain structures central to emotion processing, particularly when exposed to stress. PMID: 20694966
  41. Six functional and coding variants of the subunit genes HTR3A, HTR3B, as well as the novel HTR3C, HTR3D, and HTR3E subunits, were assessed in response to haloperidol or risperidone. PMID: 19794330
  42. RIC-3 exclusively enhances the surface expression of human homomeric 5-hydroxytryptamine type 3A (5-HT3A) receptors despite direct interactions with 5-HT3A, -C, -D, and -E subunits. PMID: 20522555
  43. This research evaluated HTR3A expression in normal and neoplastic B cells. PMID: 20516728
  44. Variants in the HTR3A receptor gene can influence the treatment outcome of clozapine in schizophrenia patients who are refractory or intolerant to typical antipsychotic therapy. PMID: 20168265
  45. Residue 312 in the 5-HT(3)A receptor and equivalent polar residues in the M3 of other Cys-loop subunits are essential determinants of homopentameric gating. PMID: 19933756
  46. This investigation on transfected HEK293 cells revealed that the Arg344His mutation of the h5-HT3A receptor, although not involved in genetic predisposition to schizophrenia, leads to a decreased density of the variant compared to the wild-type receptor. PMID: 19904001
  47. These data provide direct evidence for an extracellular N-terminal domain and an intracellular loop between the third and fourth transmembrane domains, thus supporting the conventional ligand-gated ion channel subunit topological model. PMID: 12059035
  48. Research has explored species-dependent gating mechanisms of 5-HT(3) receptors. PMID: 12457738
  49. Cell surface expression of 5-hydroxytryptamine type 3 receptors is regulated by an endoplasmic reticulum retention signal. PMID: 12750374
  50. 5HT3A receptor function and trafficking is regulated by protein kinase c through an F-actin-dependent mechanism. PMID: 12791692

Show More

Hide All

Database Links

HGNC: 5297

OMIM: 182139

KEGG: hsa:3359

UniGene: Hs.413899

Protein Families
Ligand-gated ion channel (TC 1.A.9) family, 5-hydroxytryptamine receptor (TC 1.A.9.2) subfamily, HTR3A sub-subfamily
Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in cerebral cortex, amygdala, hippocampus, and testis. Detected in monocytes of the spleen and tonsil, in small and large intestine, uterus, prostate, ovary and placenta.

Q&A

What is the structure and functional organization of human HTR3A?

Human HTR3A is a member of the Cys-loop receptor family, functioning as a ligand-gated ion channel. In its native state, HTR3A forms homopentameric or heteropentameric structures with other subunits. The receptor requires proper assembly to form functional channels that mediate rapid signal transduction in response to serotonin (5-hydroxytryptamine) . Unlike other G-protein coupled serotonin receptors, HTR3A mediates fast excitatory synaptic transmission through direct ion channel activity when activated by serotonin. Structural studies using electron microscopy have shown that purified human HTR3A receptors maintain pentameric assembly, with reconstructed 3D density maps fitting well with previously determined mouse 5-HT3A structures .

How does HTR3A expression vary across development and brain regions?

HTR3A exhibits dynamic expression patterns during development. Studies using transgenic Htr3a-EGFP reporter mice have shown that expression is first observed at 10 days post coitus (dpc) in neural crest derivatives and in the neural tube . In the developing brain, expression is detected in lumbosacral dorsal root ganglia (DRG) by 12 dpc, showing a rostral-to-caudal gradient .

In mature nervous tissue, HTR3A is notably expressed in:

  • GABAergic interneurons in neocortex and limbic structures derived from the caudal ganglionic eminence

  • Specific glutamatergic neurons, including Cajal-Retzius cells in the cortex and granule cells in the cerebellum

  • Approximately 30% of superficial GABAergic interneurons in the somatosensory cortex

HTR3A-expressing interneurons often co-express other markers including cholecystokinin (CCK), vasoactive intestinal peptide (VIP), neuropeptide Y (NPY), and occasionally calretinin (CR) and/or reelin, but typically not parvalbumin (PV) or somatostatin (SST) .

What are the key differences between human and rodent HTR3A receptors?

The genetics and expression of HTR3A differ significantly between humans and rodents, which is important for translational research. Key differences include:

  • Complexity: Humans have additional splice variants of HTR3A not found in rodents

  • Additional genes: Humans possess three additional receptor genes (HTR3C-E) that are absent in rodents

  • Heteromeric assembly: While both require HTR3A for functional receptors, the expression of HTR3B in rodent CNS is controversial, whereas in humans, HTR3B can co-assemble with HTR3A to form heteromeric HTR3A/B receptors

  • Expression patterns: The functional significance and distribution of HTR3A may vary between species, requiring careful interpretation when translating findings from animal models

These differences highlight the need for caution when extrapolating findings from rodent models to human applications .

What is the most efficient system for recombinant HTR3A expression?

The BacMam expression system has demonstrated superior efficiency for recombinant human HTR3A production. This approach involves:

  • Insertion of codon-optimized human HTR3A cDNA into a modified BacMam vector containing:

    • IgG leader sequence

    • 8×His tag linked with two-Maltose Binding Proteins (MBP)

    • TEV protease cleavage site

  • Generation of baculoviruses for transduction of HEK293F cells

  • Expression optimization: Using this system yields approximately 0.5 milligram of human HTR3A receptor per liter of cell culture, significantly higher than traditional expression systems

The BacMam system offers several advantages over alternative expression methods:

  • Higher yield of properly folded protein

  • Mammalian cell expression ensures proper post-translational modifications

  • Scalability for structural and biochemical studies

  • Suitability for high-throughput screening of different constructs

What purification strategy yields the highest quality HTR3A protein for structural studies?

An optimized multi-step purification protocol has been developed to obtain high-quality, homogeneous HTR3A protein suitable for structural and functional studies:

  • Membrane solubilization: After harvesting, cells are lysed and membrane proteins are solubilized using the detergent C12E9, which has proven effective at maintaining HTR3A stability

  • Affinity purification: MBP affinity chromatography yields good recovery with high purity and homogeneity. This is followed by:

    • TEV protease treatment to remove affinity tags

    • Immobilized metal ion affinity chromatography (IMAC)

  • Size-exclusion chromatography (SEC): Final purification and buffer exchange using SEC, which also confirms the pentameric assembly of the purified receptors

  • Quality control: Western blot, SDS-PAGE, and negative stain electron microscopy to verify purity, homogeneity, and structural integrity

This protocol results in monodisperse, pentameric HTR3A receptors that maintain their native conformation and are suitable for advanced structural studies including electron microscopy-based 3D reconstruction .

How does HTR3A contribute to neural circuit formation during development?

HTR3A plays critical roles in neural circuit development through several mechanisms:

  • Regulation of GABAergic interneuron development: HTR3A is expressed on specific interneuron populations derived from the caudal ganglionic eminence, influencing their migration, positioning, and integration into cortical circuits

  • Modulation of glutamatergic signaling: HTR3A expression on Cajal-Retzius cells in the cortex and granule cells in the cerebellum regulates morphology, positioning, and connectivity of the local microcircuitry

  • Dynamic developmental expression: HTR3A shows carefully regulated spatiotemporal expression patterns that coincide with critical periods of neuronal differentiation, migration, and circuit formation

  • Sensory system development: In peripheral sensory neurons, HTR3A expression follows a rostral-to-caudal gradient, with expression in lumbosacral dorsal root ganglia beginning around 12 dpc, suggesting a role in the establishment of sensory circuits

These functions position HTR3A as a key regulator of network formation during CNS development, with potential implications for neurodevelopmental disorders in which serotonin signaling is disrupted .

What is the relationship between HTR3A and other neurotransmitter systems in sensory neurons?

HTR3A-expressing sensory neurons show complex interactions with other neurotransmitter systems and neuropeptides:

  • Co-expression patterns in DRG neurons:

    • HTR3A partially co-localizes with neuropeptides CGRP and Substance P

    • HTR3A is expressed in neurons positive for the capsaicin receptor TRPV1

    • No co-localization is observed with TRPV4 receptor

    • A majority of HTR3A+ DRG neurons express NF200, a marker of myelinated Aδ neurons

  • Functional integration with cholinergic signaling: HTR3A-expressing neocortical interneurons can be excited by both serotonin (via HTR3A) and acetylcholine (via nicotinic receptors), suggesting integration of multiple neuromodulatory inputs

  • Thalamocortical connectivity: At least a subset of HTR3A-positive cells receives monosynaptic thalamocortical input, leading to strong depolarization. This positions HTR3A-expressing interneurons as potential components of feedforward inhibitory networks whose sensitivity is regulated by serotonergic and cholinergic inputs

  • Bladder innervation: HTR3A is expressed in a substantial proportion of bladder-projecting DRG neurons at both rostral (L1, L2) and caudal (L6, S1) axial levels, with different co-expression patterns at different levels:

    • Most bladder-projecting HTR3A+ neurons co-expressing CGRP, Substance P, or TRPV1 are found in L1, L2 DRG

    • HTR3A+/NF200+ bladder-projecting neurons are predominantly from L6, S1 axial levels

These expression patterns suggest that HTR3A plays important roles in modulating the sensitivity and function of diverse sensory neuron populations.

How can HTR3A genetic variants be studied for their association with neuropsychiatric disorders?

HTR3A genetic variants have been implicated in several neuropsychiatric conditions. Research approaches to investigate these associations include:

  • SNP identification and genotyping:

    • Focus on key polymorphisms like C178T in the 5′UTR region of HTR3A

    • Use high-throughput genotyping methods for large population studies

  • Functional characterization of variants:

    • Generate recombinant mutant receptors containing specific variants

    • Assess changes in expression levels, cellular localization, and channel function

    • Measure altered ligand binding or ion channel properties using electrophysiological techniques

  • Clinical correlation studies:

    • Investigate associations with specific conditions including bipolar disorder, schizophrenia, altered harm avoidance, substance dependence, and depression

    • Correlate variants with neuroimaging findings, such as amygdala and prefrontal cortex activity, and gray matter volume in prefrontal cortex and hippocampus

  • Environmental interaction analysis:

    • Examine how variants interact with environmental factors like early life quality to influence phenotypes

    • Study gene-environment interactions that may modify disease risk or treatment response

This multi-level approach allows researchers to connect HTR3A genetic variation to specific molecular, cellular, and behavioral phenotypes relevant to neuropsychiatric disorders.

What are the most effective methods for studying HTR3A function in specific neuronal populations?

Advanced techniques for investigating HTR3A function in specific neuronal populations include:

  • Transgenic reporter models:

    • Utilize transgenic Htr3a-EGFP mouse lines for visualization of HTR3A-expressing neurons

    • Combine with immunohistochemistry to characterize co-expression with other markers

    • Perform lineage tracing to track the development and fate of HTR3A-expressing cells

  • Cell-type specific manipulation:

    • Implement Cre-loxP systems for conditional knockout or overexpression specifically in HTR3A-expressing cells

    • Use optogenetic or chemogenetic approaches (e.g., DREADDs) to selectively activate or inhibit HTR3A-expressing neurons in vivo

  • Functional assessment:

    • Patch-clamp electrophysiology to measure channel properties in identified HTR3A+ neurons

    • Calcium imaging to assess population activity of HTR3A+ neurons in response to various stimuli

    • In vivo multi-electrode recordings combined with optogenetic identification of HTR3A+ neurons

  • Circuit mapping:

    • Retrograde tracing methods to identify sources of inputs to HTR3A+ neurons

    • Anterograde tracing to map projections from HTR3A+ neurons

    • Monosynaptic rabies virus tracing to map the whole-brain inputs to specific HTR3A+ neuronal populations

  • Behavioral paradigms:

    • Assess behavioral consequences of manipulating HTR3A function in specific circuits

    • Correlate activity of HTR3A+ neurons with specific behavioral states or responses

These approaches enable detailed investigation of HTR3A's role in neural circuit function and behavior with high temporal and spatial precision.

How does HTR3A contribute to Alzheimer's disease pathology and potential treatment approaches?

Recent evidence suggests HTR3A plays a role in Alzheimer's disease (AD) pathology through several mechanisms:

  • Contribution to amyloid pathology:

    • HTR3A-positive interneurons have been found to partly contribute to the generation of Aβ peptides in AD models

    • Some amyloid precursor protein-positive or β-site amyloid precursor protein cleaving enzyme-1-positive neurites near Aβ plaques co-localize with HTR3A interneurons

    • This suggests HTR3A+ interneurons may be involved in the early stages of Aβ generation

  • Therapeutic targeting of HTR3A:

    • Treatment with tropisetron, a HTR3 antagonist, in APP/PS1 mouse models of AD for 8 consecutive weeks demonstrated:

      • Partial reversal of cognitive deficits

      • Remarkable reduction in Aβ plaques

      • Decreased neuroinflammation

      • Reduced expression of HTR3

      • Inhibition of the calcineurin/nuclear factor of activated T-cell 4 signaling pathway

These findings suggest HTR3A antagonists may represent a novel therapeutic approach for AD, potentially targeting both Aβ production and neuroinflammatory processes that contribute to disease progression.

What is the role of HTR3A in cancer biology, particularly in lung adenocarcinoma?

HTR3A has emerged as a significant factor in cancer biology, particularly in lung adenocarcinoma:

  • Expression correlation with cancer aggressiveness:

    • Higher expression levels of HTR3A are detected in more aggressive subtypes of lung adenocarcinoma (acinar, papillary, and solid) compared to less aggressive forms (adenocarcinoma in situ and lepidic adenocarcinoma)

    • HTR3A expression correlates with Ki-67 positivity, a widely used proliferation marker

  • Functional impact on cancer cell behavior:

    • HTR3A knockdown in lung adenocarcinoma cells attenuates proliferation

    • The mechanism appears to involve reduced ERK phosphorylation, suggesting HTR3A modulates key proliferative signaling pathways

  • Therapeutic implications:

    • 5-HT3 receptor antagonists like tropisetron show therapeutic potential for lung adenocarcinoma treatment

    • These compounds may represent repurposing opportunities, as many 5-HT3 antagonists are already approved for clinical use as antiemetics

This research highlights HTR3A as both a potential biomarker for aggressive lung adenocarcinoma and a therapeutic target, opening new avenues for cancer treatment strategies.

What are the critical factors for successful HTR3A antibody validation in immunohistochemistry and Western blot applications?

Proper antibody validation is essential for reliable HTR3A detection in experimental applications:

  • Antibody selection considerations:

    • Target specific epitopes unique to HTR3A, avoiding regions of homology with other HTR3 subunits

    • Consider both polyclonal and monoclonal antibodies, each with distinct advantages

    • Validate using both recombinant protein and knockout/knockdown controls

  • Western blot validation protocol:

    • Include positive controls (tissues/cells known to express HTR3A)

    • Include negative controls (HTR3A knockout or knockdown samples)

    • Verify molecular weight (approximately 53 kDa for human HTR3A)

    • Test for cross-reactivity with other HTR3 subunits

    • Assess specificity across different species if performing comparative studies

  • Immunohistochemistry validation:

    • Compare staining patterns with in situ hybridization or reporter gene expression

    • Validate across multiple tissue fixation and preparation protocols

    • Confirm specificity using peptide blocking experiments

    • Establish optimal antibody concentration through titration

    • Include proper isotype controls

  • Common pitfalls to avoid:

    • Non-specific binding due to inadequate blocking

    • False negative results due to epitope masking during fixation

    • Cross-reactivity with other HTR3 subunits

    • Variability in HTR3A detection due to dynamic expression patterns during development

What are the optimal experimental conditions for HTR3A functional studies in electrophysiology?

Electrophysiological characterization of HTR3A requires specific experimental conditions to obtain reliable data:

  • Expression system selection:

    • Heterologous expression in HEK293 or Xenopus oocytes for isolated receptor studies

    • Primary neuronal cultures for studying HTR3A in a more physiological context

    • Brain slice preparations for investigating HTR3A in intact circuits

  • Recording configuration optimization:

    • Whole-cell patch clamp for measuring currents across the entire cell

    • Outside-out patches for studying single channel properties

    • Perforated patch for maintaining intracellular signaling integrity

  • Solution composition:

    • External solution (in mM): 140 NaCl, 2.8 KCl, 2 CaCl2, 2 MgCl2, 10 HEPES, 10 glucose (pH 7.4)

    • Internal solution (in mM): 140 CsCl, 2 MgCl2, 10 HEPES, 10 EGTA, 2 ATP (pH 7.2)

    • Adjust osmolarity to 290-310 mOsm

  • Pharmacological isolation:

    • Apply synaptic blockers (APV, CNQX, bicuculline) when studying in neuronal preparations

    • Use specific HTR3A agonists (e.g., m-chlorophenylbiguanide) for receptor activation

    • Apply antagonists (e.g., tropisetron, ondansetron) to confirm specificity

  • Recording parameters:

    • Holding potential typically at -60 to -80 mV

    • Fast solution exchange systems (<100 ms) for accurate activation kinetics

    • Temperature control (ideally at physiological temperature, 35-37°C)

    • Series resistance compensation to minimize voltage errors

  • Analysis considerations:

    • Assess desensitization kinetics with prolonged agonist application

    • Measure reversal potential to confirm ion selectivity

    • Generate concentration-response curves to determine EC50 values

    • Quantify rise and decay time constants

What are the most promising approaches for targeting HTR3A in novel therapeutic applications?

Emerging research suggests several promising avenues for therapeutic targeting of HTR3A:

  • Neurodevelopmental disorders:

    • Development of HTR3A modulators that can influence interneuron function during critical developmental periods

    • Creation of subtype-selective compounds that target specific HTR3A-expressing neuronal populations

    • Investigation of critical windows for intervention in conditions with altered serotonergic signaling

  • Alzheimer's disease:

    • Refinement of HTR3A antagonists like tropisetron that have shown promise in reducing Aβ plaque formation

    • Development of combination therapies targeting HTR3A alongside other pathways involved in neurodegeneration

    • Investigation of prophylactic treatment approaches during early disease stages

  • Cancer therapeutics:

    • Repurposing existing HTR3A antagonists as adjuvant therapy for lung adenocarcinoma

    • Development of targeted delivery systems to concentrate HTR3A antagonists in tumor tissues

    • Exploration of synergistic effects with standard chemotherapeutic agents

    • Identification of biomarkers to predict responsiveness to HTR3A-targeted therapies

  • Pain management:

    • Creation of peripherally restricted HTR3A modulators for visceral pain conditions

    • Development of subtype-selective compounds targeting specific DRG populations

    • Investigation of HTR3A-targeted approaches for neuropathic pain conditions

What technological advances are needed to better understand HTR3A's role in complex neural circuits?

Several technological advancements would facilitate deeper understanding of HTR3A's role in neural circuit function:

  • Advanced imaging technologies:

    • Super-resolution microscopy techniques to visualize HTR3A distribution at synapses

    • Expansion microscopy combined with multiplexed immunolabeling to map HTR3A in relation to other molecular markers

    • Improved voltage or calcium indicators for real-time monitoring of HTR3A+ neuron activity in vivo

  • Single-cell omics approaches:

    • Single-cell RNA sequencing of HTR3A+ neurons across development and in different brain regions

    • Spatial transcriptomics to map HTR3A expression in preserved tissue architecture

    • Single-cell proteomics to characterize the complete protein complement of HTR3A+ neurons

  • Precision genetic manipulation:

    • CRISPR-based approaches for introducing specific HTR3A variants to model human polymorphisms

    • Temporally precise genetic manipulation systems to target HTR3A at specific developmental stages

    • Cell-type and circuit-specific conditional manipulation of HTR3A expression

  • Advanced functional analysis:

    • Miniaturized microscopes for calcium imaging in freely moving animals

    • Simultaneous recording and manipulation of multiple HTR3A+ neuronal populations

    • Closed-loop systems that can detect and manipulate HTR3A+ neuron activity in response to specific behavioral states

  • Computational modeling:

    • Integration of multi-modal data into comprehensive models of HTR3A function

    • Simulation of HTR3A's impact on neural circuit dynamics

    • Predictive models for HTR3A-targeted drug development

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.