Recombinant Human 5-hydroxytryptamine receptor 3E (HTR3E), partial

Shipped with Ice Packs
In Stock

Description

Functional Role and Subunit Interactions

  • Ligand-Gated Ion Channel Activity: HTR3E forms heteropentameric receptors with HTR3A subunits, enabling serotonin-induced cation flux (primarily Na⁺ and K⁺) . Unlike homomeric HTR3A receptors, HTR3E cannot independently form functional channels .

  • Post-Translational Modifications:

    • Requires co-expression with HTR3A for proper trafficking to the cell membrane .

    • Potential phosphorylation sites in the intracellular loop modulate channel kinetics .

Genetic Variants and Disease Associations

A functional single-nucleotide polymorphism (SNP) in HTR3E (rs56109847) has been linked to irritable bowel syndrome with diarrhea (IBS-D):

VariantAssociationMechanism
rs56109847 (G>A)Increased IBS-D risk in Chinese Han women Disrupts miR-510 binding, elevating HTR3E expression in colonic mucosa
GA Genotype2.5-fold higher HTR3E expression compared to GG genotype Altered serotonin signaling in gastrointestinal neurons

Metabolic and Immune Modulation

  • HTR3E-containing receptors influence adipose tissue inflammation and glucose homeostasis .

  • Lipid rafts modulate receptor stability, with cholesterol interactions affecting ion conductance .

Expression and Localization

  • Tissue Specificity: Predominantly expressed in gastrointestinal mucosal glands, with minimal stromal expression .

  • Subcellular Localization: Multi-pass transmembrane protein localized to the plasma membrane .

Research Applications

  • Drug Development: Used to screen 5-HT3 receptor antagonists (e.g., ondansetron, granisetron) for antiemetic therapies .

  • Disease Modeling: IBS-D studies leverage recombinant HTR3E to explore serotonin dysregulation .

  • Structural Biology: Serves as a template for cryo-EM and X-ray crystallography studies .

Product Specs

Buffer
Lyophilized from Tris/PBS-based buffer, containing 6% Trehalose.
Form
Available in both liquid and lyophilized powder formats.
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order and we will fulfill your request.
Lead Time
Typically, we can ship products within 1-3 working days after receiving your order. Delivery time may vary based on the purchase method and location. For specific delivery times, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 6xHis-SUMO-tagged
Synonyms
HTR3E; 5-hydroxytryptamine receptor 3E; 5-HT3-E; 5-HT3E; Serotonin receptor 3E
Datasheet & Coa
Please contact us to get it.
Expression Region
72-229aa&241-456aa
Mol. Weight
58.2kDa
Protein Length
Partial
Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Others
Source
in vitro E.coli expression system
Species
Homo sapiens(Human)
Target Names
HTR3E
Target Protein Sequence
MSAILDVNEQLHLLSSFLWLEMVWDNPFISWNPEECEGITKMSMAAKNLWLPDIFIIELMDVDKTPKGLTAYVSNEGRIRYKKPMKVDSICNLDIFYFPFDQQNCTLTFSSFLYTVDSMLLDMEKEVWEITDASRNILQTHGEWELLGLSKATAKLSRVAIRRRPSLYVINLLVPSGFLVAIDALSFYLPVKSGNRVPFKITLLLGYNVFLLMMSDLLPTSGTPLIGVYFALCLSLMVGSLLETIFITHLLHVATTQPPPLPRWLHSLLLHCNSPGRCCPTAPQKENKGPGLTPTHLPGVKEPEVSAGQMPGPAEAELTGGSEWTRAQREHEAQKQHSVELWLQFSHAMDAMLFRLYLLFMASSIITVICLWNT
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
This protein is one of several receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor acts as a ligand-gated ion channel, triggering fast, depolarizing responses upon activation. It is a cation-specific ion channel with relatively low selectivity.
Gene References Into Functions
  1. The HTR3E gene remained statistically significant after adjusting for the number of variants investigated. PMID: 23928294
  2. Data show that the 5-HT3C, 5-HT3D, and 5-HT3E subunits are co-expressed with 5-HT3A in the cell bodies of myenteric neurons. Additionally, 5-HT3A and 5-HT3D were found to be expressed in the submucosal plexus of the human large intestine. PMID: 21192076
  3. An observational study examining gene-disease association. (HuGE Navigator) PMID: 20538960
  4. Six functional and coding variants of the subunit genes HTR3A, HTR3B, as well as the novel HTR3C, HTR3D, and HTR3E subunits were assessed in relation to the response to haloperidol or risperidone. PMID: 19794330
  5. An observational study of gene-disease association, gene-environment interaction, and pharmacogenomic/toxicogenomic. (HuGE Navigator) PMID: 20602613
  6. This study provides additional evidence supporting a role of the serotonergic system and the 5-HT3 receptor in schizophrenia. PMID: 20356718
  7. An observational study of gene-disease association. (HuGE Navigator) PMID: 20356718
  8. Data suggest that 5-HT3 receptors located in the nucleus tractus solitarius contribute to stress-induced suppression of the baroreflex. PMID: 18573276
  9. MicroRNA-510 target site within the 3'UTR of HTR3A and HTR3E are associated with irritable bowel syndrome with diarrhea. PMID: 18614545
  10. The binding site for miR-510 is exclusively found in the 3' UTR of the HTR3E gene. No predicted binding site for miR-510 exists in the 3' UTR of HTR3A. PMID: 18614545
  11. An observational study of gene-disease association. (HuGE Navigator) PMID: 20021265

Show More

Hide All

Database Links

HGNC: 24005

OMIM: 610123

KEGG: hsa:285242

STRING: 9606.ENSP00000335511

UniGene: Hs.449179

Protein Families
Ligand-gated ion channel (TC 1.A.9) family, 5-hydroxytryptamine receptor (TC 1.A.9.2) subfamily, HTR3E sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Note=Presumably retained within the endoplasmic reticulum unless complexed with HTR3A.
Tissue Specificity
Expressed in adult colon and intestine.

Q&A

What is HTR3E and how does it relate to other 5-HT3 receptor subunits?

HTR3E is one of five identified 5-HT3 receptor subunits (A through E) in the human serotonin receptor family. These receptors belong to the 'Cys-loop' family of ligand-gated ion channels that mediate fast excitatory and inhibitory transmission in the nervous system. Unlike the previously characterized 5-HT3A and 5-HT3B subunits, HTR3E is a relatively novel gene whose functional significance remains incompletely determined. Notably, HTR3E cannot form functional homomeric receptors but may modify the expression or function of 5-HT3A receptors when co-expressed .

What is the current understanding of HTR3E functionality when expressed alone?

Patch clamp electrophysiology studies have demonstrated that HTR3E subunits are non-functional when expressed alone. Unlike 5-HT3A, which can form functional homomeric channels, HTR3E requires co-expression with other subunits, particularly 5-HT3A, to potentially contribute to channel function. This characteristic is consistent with HTR3C and distinguishes these newer subunits from the more extensively studied 5-HT3B subunit .

What are the recommended methods for heterologous expression of HTR3E?

For successful heterologous expression of recombinant HTR3E, researchers should consider the following methodological approach:

  • Cell selection: Human embryonic kidney (HEK293) cells provide an established system for expression of 5-HT3 receptor subunits.

  • Vector construction: Insert the full HTR3E coding sequence into a mammalian expression vector containing a strong promoter (e.g., CMV).

  • Transfection protocol: For co-expression studies with 5-HT3A, use a lipid-based transfection method such as Lipofectamine 2000. Optimal results are achieved with a ratio of 400 ng HTR3E-containing plasmid per well in 24-well plates for most applications .

  • Expression validation: Confirm membrane expression using immunocytochemistry with subunit-specific antibodies or epitope tags.

  • Functional assessment: Employ patch-clamp electrophysiology to assess channel properties, particularly when co-expressed with 5-HT3A.

How can researchers study HTR3E interactions with 5-HT3A receptors?

To investigate potential heteromeric receptor interactions between HTR3E and 5-HT3A, researchers should implement co-transfection studies using the following approach:

  • Co-transfection: Transfect cells with both HTR3E and HTR3A plasmids at controlled ratios to evaluate dose-dependent effects on receptor expression and function.

  • Electrophysiological assessment: Use patch-clamp recordings to measure the functional properties of the resulting channels, including current rectification, kinetics, and response to 5-HT3 receptor agonists and antagonists.

  • Control experiments: Include parallel experiments with 5-HT3A alone and with established heteromeric combinations (e.g., 5-HT3A + 5-HT3B) for comparison.

Current research indicates that co-expression of HTR3E with 5-HT3A modifies receptor expression or function, although the lack of distinct effects on current rectification, kinetics, or pharmacology does not provide unequivocal evidence for direct contribution of HTR3E to the ion channel pore lining .

How does the functional variant rs56109847 in HTR3E affect gene expression?

The single nucleotide polymorphism rs56109847 in the 3′-untranslated region (3′-UTR) of the HTR3E gene has significant functional implications. This variant is located in the recognition site for microRNA-510 (miR-510) binding. Research utilizing dual-luciferase reporter assays has demonstrated that this polymorphism affects the binding ability of miR-510 to the HTR3E 3′-UTR, potentially influencing mRNA stability and translation efficiency.

Methodology for investigating this variant includes:

  • PCR amplification of the full-length HTR3E 3′-UTR fragment using primers that introduce restriction sites for subsequent cloning.

  • Construction of reporter plasmids containing either the wild-type or variant 3′-UTR sequence downstream of the Renilla luciferase gene.

  • Co-transfection of these constructs with miR-510 expression plasmids to assess the functional impact on gene expression.

  • Quantification of the effect using dual-luciferase reporter assays that normalize for transfection efficiency .

This variant has been particularly associated with diarrhea-predominant conditions in females, suggesting sex-specific effects of HTR3E modulation .

What is the comparative distribution of HTR3E mRNA across different brain regions?

Expression analysis of HTR3E across human brain regions reveals a pattern distinct from other 5-HT3 receptor subunits. While detailed quantitative data on HTR3E specifically is still emerging, research on the related HTR3A and HTR3B subunits provides context for understanding potential HTR3E distribution:

Brain RegionHTR3A ExpressionHTR3B ExpressionHTR3E Expression
AmygdalaModerate to highProminentDetected
Frontal cortexModerateProminentDetected
HippocampusModerateModerateDetected
CerebellumLow/undetectableLow/undetectableNot fully characterized
Brain stemModerateProminentDetected
CaudatePresentVariableDetected
ThalamusPresentVariableDetected

HTR3E is detected in most brain regions examined, with the notable exception of the cerebellum. This distribution pattern suggests potential roles in emotional processing (amygdala), executive function (frontal cortex), and autonomic regulation (brain stem) .

How do HTR3E subunits influence pharmacological responses to 5-HT3 receptor ligands?

The incorporation of HTR3E into heteromeric receptors may contribute to pharmacological diversity of 5-HT3 receptors, potentially explaining tissue-specific differences in drug responses. Current research indicates that co-expression of HTR3E with 5-HT3A does not produce unequivocal evidence of distinct effects on pharmacology compared to homomeric 5-HT3A receptors.

To investigate this phenomenon, researchers should consider:

  • Pharmacological profiling: Conduct detailed concentration-response studies with various 5-HT3 receptor agonists (e.g., serotonin, m-chlorophenylbiguanide) and antagonists (e.g., ondansetron, granisetron) in expression systems with and without HTR3E.

  • Binding studies: Perform radioligand binding assays to determine if HTR3E affects ligand affinity in heteromeric receptors.

  • Allosteric modulation: Investigate whether HTR3E confers sensitivity to novel allosteric modulators not active at conventional 5-HT3A or 5-HT3AB receptors.

The clinical relevance of such investigations is substantial, given the therapeutic application of 5-HT3 receptor antagonists in conditions like irritable bowel syndrome and chemotherapy-induced nausea .

What are the methodological approaches for characterizing HTR3E in native tissues?

Due to the lack of HTR3E-selective pharmacological tools, characterizing native HTR3E-containing receptors requires sophisticated molecular and electrophysiological approaches:

  • Single-cell RT-PCR: Combine patch-clamp recordings with single-cell RT-PCR to correlate 5-HT3 receptor currents with HTR3E expression in individual neurons or enterocytes.

  • Subunit-specific antibodies: Develop and validate antibodies targeting unique epitopes of HTR3E for immunohistochemistry and western blotting applications.

  • Genetic approaches: Utilize CRISPR-Cas9 technology to introduce tagged versions of HTR3E or create conditional knockout models in non-rodent mammalian systems (since HTR3E is absent in rodents).

  • Transcriptomic analysis: Apply RNA sequencing to identify co-expression patterns of HTR3E with other subunits across different tissues and cell types.

These methods are particularly important given that HTR3E is conserved in multiple mammalian species but absent in commonly used rodent models, necessitating alternative experimental systems for translational research .

What is the evidence linking HTR3E to psychiatric disorders?

The involvement of 5-HT3 receptors in learning, cognition, and emotion regulation suggests potential roles for HTR3E in psychiatric conditions. While direct evidence specifically for HTR3E remains limited, research on the 5-HT3 receptor family provides valuable context:

  • Genetic associations: Functional variants in related subunits (HTR3A and HTR3B) have been associated with bipolar affective disorder (BPAD), major depression, and anxiety disorders.

  • Brain expression patterns: HTR3E is expressed in brain regions relevant to psychiatric disorders, including the amygdala and frontal cortex, where the related HTR3B subunit shows prominent expression.

  • Pharmacological relevance: 5-HT3 receptor antagonists demonstrate improvement in depressive symptoms, memory, and cognition in some psychiatric patients.

The confirmation of HTR3B variant p.Y129S association with BPAD (pooled odds ratio of 0.881, P=0.009) in large European cohorts suggests that further investigation of HTR3E variants in psychiatric populations is warranted .

How does HTR3E function differ between gastrointestinal and neuronal tissues?

The high expression of HTR3E in both gastrointestinal tract and neural tissues suggests potentially distinct functional roles in these systems. Current research indicates:

  • Tissue-specific heteromeric combinations: HTR3E may form different heteromeric combinations with other 5-HT3 subunits depending on the tissue, potentially leading to receptors with distinct properties.

  • Signaling pathway coupling: The downstream signaling pathways coupled to HTR3E-containing receptors may differ between enteric neurons and central nervous system neurons.

  • Regulatory mechanisms: Post-transcriptional regulation, such as the interaction between microRNA-510 and the HTR3E 3′-UTR, may exhibit tissue-specific patterns, as suggested by the female-specific association of the rs56109847 variant with diarrhea-predominant conditions.

Methodological approaches to investigate these differences include:

  • Comparative electrophysiology of HTR3E-containing receptors in isolated enterocytes versus neurons

  • Calcium imaging to assess receptor-mediated signaling in different cellular contexts

  • Tissue-specific conditional expression models to evaluate HTR3E functions in vivo

How can researchers overcome the challenge of HTR3E being absent in rodent models?

The absence of HTR3E in rodents presents a significant challenge for translational research. To address this limitation, researchers can implement the following strategies:

  • Alternative model organisms: Consider using non-rodent mammalian models that express HTR3E, such as non-human primates or porcine models for functional studies.

  • Humanized models: Develop transgenic rodent models expressing human HTR3E under tissue-specific promoters to study its function in vivo.

  • Human-derived systems: Utilize human-derived organoids, especially gut organoids for gastrointestinal studies and brain organoids for neurological investigations.

  • Advanced in vitro systems: Employ co-culture systems of human neurons and enterocytes to model tissue-specific HTR3E functions.

  • Clinical studies: Design targeted clinical studies focusing on HTR3E polymorphisms and their correlation with treatment responses to 5-HT3 receptor modulators .

What are the recommended protocols for addressing potential contradictions in HTR3E expression data?

Conflicting reports regarding HTR3E expression patterns may arise due to methodological differences, tissue heterogeneity, or individual variability. To address these contradictions, researchers should consider:

  • Quantitative comparison method: Employ quantitative PCR with carefully validated primers specific to HTR3E that avoid cross-reactivity with other HTR3 subunits. Include appropriate reference genes for normalization.

  • Standardized sampling: Implement precise anatomical sampling protocols to ensure consistency across studies, particularly for heterogeneous tissues like brain and gastrointestinal tract.

  • Multiple detection techniques: Combine mRNA detection (qPCR, in situ hybridization) with protein detection methods (Western blotting, immunohistochemistry with validated antibodies) to provide convergent evidence.

  • Single-cell approaches: Utilize single-cell RNA sequencing to resolve cell-type specific expression patterns that might be masked in whole-tissue analysis.

  • Demographic considerations: Account for potential sex, age, and ethnicity differences in HTR3E expression, as suggested by sex-specific associations of HTR3E variants with certain conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.