Recombinant Human 5-hydroxytryptamine receptor 4 (HTR4)

Shipped with Ice Packs
In Stock

Description

Functional Roles and Signaling

Recombinant HTR4 mimics the endogenous receptor’s signaling pathways, primarily coupling to Gαs and Gαi proteins to modulate adenylate cyclase activity and cAMP production . Key functional roles include:

Central Nervous System

  • Mood regulation: Modulates serotonin release in the prefrontal cortex, influencing depression and anxiety .

  • Cognitive functions: Implicated in learning and memory, with hippocampal-specific knockout mice showing impaired mood-related phenotypes .

  • Neurodevelopment: Hypomethylation of the HTR4 promoter is linked to autism spectrum disorder (ASD), particularly in males .

Peripheral Functions

  • Cardiovascular: Enhances cardiac contractility and chronotropy via cAMP-dependent pathways; implicated in arrhythmias and sepsis .

  • Gastrointestinal: Stimulates colonic motility and inhibits visceral hypersensitivity, making it a target for constipation and irritable bowel syndrome .

DNA Methylation and ASD

Hypomethylation of the HTR4 promoter (chr5: 148,032,968–148,033,058) correlates with ASD risk in males. Key data:

GroupMedian PMR (%)P-value (Age-Adjusted)
ASD Male Cases65.380.014
Healthy Males93.07
ASD Female Cases120.400.013 (vs. ASD males)

PMR = Percentage of Methylated Reference. Data from .

Dual-luciferase assays confirmed that the HTR4 promoter fragment enhances transcriptional activity (2.01-fold increase; P = 0.0065) .

Cardiac Signaling

In human cardiac myocytes, HTR4 agonists (e.g., serotonin) increase contractile force via cAMP-dependent mechanisms. Phosphodiesterase inhibitors (e.g., rolipram) amplify these effects, while nitric oxide (NO) donors (e.g., L-NAME) reduce efficacy .

Therapeutic Potential

  • Gastrointestinal disorders: DSP-6952 (a 5-HT4 agonist) enhances colonic transit and reduces visceral pain in rodent models .

  • Neuropsychiatric diseases: Hippocampal HTR4 deletion models highlight its role in mood regulation, suggesting agonist/antagonist therapies for depression and anxiety .

Production and Experimental Tools

Recombinant HTR4 is commercially available in membrane preparations for binding assays and as purified proteins for structural studies:

Product TypeApplicationSource
Membrane PreparationsLigand-binding assays (e.g., GTPγS)
Purified ProteinSDS-PAGE, ELISA, crystallography
AntibodiesIHC, flow cytometry (e.g., MAB6545)

Example: Membrane preparations exhibit a K<sub>d</sub> of 0.46 nM for the radioligand [3^3H]-GR113808, enabling high-throughput screening (HTS) for agonists/antagonists .

Key Research Challenges

  • Isoform specificity: Functional differences between HTR4 splice variants remain poorly understood .

  • Therapeutic selectivity: Off-target effects in the heart and CNS necessitate rigorous pharmacological profiling .

  • Biomarker validation: Further studies are needed to confirm HTR4 promoter hypomethylation as a biomarker for ASD .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery information.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your own protocols.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
HTR4; 5-hydroxytryptamine receptor 4; 5-HT-4; 5-HT4; Serotonin receptor 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-388
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIV SLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYY AICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSN STYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRP QSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWL GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRD AVECGGQWESQCHPPATSPLVAAQPSDT
Uniprot No.

Target Background

Function
This receptor is one of several that bind to 5-hydroxytryptamine (serotonin), a biogenic hormone functioning as a neurotransmitter, hormone, and mitogen. The receptor's activity is mediated by G proteins that stimulate adenylate cyclase.
Gene References Into Functions
  1. Studies have shown a negative correlation between testosterone levels and global 5-HT4R levels, suggesting that men with higher testosterone levels may have increased cerebral serotonergic activity. PMID: 28426945
  2. l-Lysine significantly reduced the surge of plasma aldosterone induced by metoclopramide, indicating that l-Lysine effectively antagonizes adrenal 5-HT4 receptors in vivo. PMID: 28103616
  3. Acute administration of the 5-hydroxytryptamine4 (5-HT4) receptor agonist, mosapride, or esophageal infusion of the transient receptor potential vanilloid receptor-1 (TRPV1) agonist capsaicin promotes secondary peristalsis. Esophageal infusion with capsaicin-containing red pepper sauce suspension generates greater mechanosensitivity, as measured by secondary peristalsis, compared to the 5-HT4 receptor agonist mosapride. PMID: 27438088
  4. Research replicates previous findings of a negative association between 5-HT 4R binding and memory performance in an independent cohort, and provides novel evidence linking 5-HT 4R binding, as a biomarker for synaptic 5-HT levels, to the mnestic processing of positive and neutral word stimuli in healthy individuals. PMID: 28413715
  5. This study suggests that HTR4 signaling upregulates ERbeta expression in hormone-naive prostate cancer and could potentially influence biological processes in this type of cancer. PMID: 28195088
  6. Data suggests that the 5-HT4 receptor plays a role in the neurobiological mechanism underlying familial risk for depression, and that lower striatal 5-HT4 receptor binding is associated with increased risk of developing major depression disorder. PMID: 25522384
  7. PDE3A1 and PDE4D3 are integrated into complexes containing the 5-HT4(b) receptor and may therefore regulate 5-HT4(b) receptor-mediated signaling. PMID: 25101859
  8. Findings of altered lung function and increased AHR in Htr4-null mice support a causal relationship between genetic variation in HTR4 and pulmonary function identified in human genome-wide association studies. PMID: 25342126
  9. This study demonstrates that 5-hydroxytryptamine (serotonin) receptor 4 regulates memory. PMID: 25622143
  10. ADAM19 rs1422795 and HTR4 rs11168048 are associated with pulmonary function. PMID: 24951661
  11. This is the first transgenic model to study human 5-HTreceptor in the atrium ex vivo or in vivo. PMID: 23307014
  12. Stimulation of central 5-HT4 receptors has the potential to modify disease progression in a transgenic mouse model of Alzheimer's disease. PMID: 23474291
  13. Collectively, these data suggest a role for HTR4 in lung development, which may partially explain the genetic association with lung function. PMID: 23890215
  14. Our findings suggest that HTR4 polymorphisms may not play a significant role in the susceptibility for suicidal behavior in individuals with schizophrenia. PMID: 22842674
  15. These results indicate a prominent role of 5-HT(4)R in promoting angiogenesis. PMID: 22903372
  16. Results suggest a significant role for the CHRNA5/3 region as a genetic risk factor for airflow obstruction, independent of smoking, and implicate the HTR4 gene in the etiology of airflow obstruction. PMID: 22837378
  17. Our findings align with a model where the 5-HTTLPR S allele is associated with relatively increased serotonin levels. PMID: 22584237
  18. These findings suggest that the 5-HT(4)R is critically involved in reward circuits that regulate food intake. PMID: 22709820
  19. Mucosal 5-HT(4) receptor activation can mediate the prokinetic and antinociceptive actions of 5-HT(4)R agonists. PMID: 22226658
  20. The occurrence of heterogeneous post-translational modifications (PTMs) on transgenic proteins, along with the complications that non-native PTMs can cause, underscores the importance of characterizing both endogenous and heterologous protein targets. PMID: 22145929
  21. 5-HT4 receptor binding was positively correlated to amyloid beta (A4) burden and negatively correlated to MMSE score in Alzheimer's disease patients. PMID: 21673407
  22. HTR4 polymorphism was associated with COPD risk and lung function decline. PMID: 21965014
  23. SNPs and haplotypes of the HTR4 gene were associated with the asthma phenotype, suggesting that genetic variation in HTR4 may influence susceptibility to asthma development. PMID: 21382128
  24. The relatively stable HT4 5-receptor binding with aging contrasts with other receptor subtypes, which generally decrease with aging. PMID: 21364600
  25. This study demonstrates the presence of the 5-HT4 receptor in the human thalamus prenatally. PMID: 20538346
  26. No association was found in the family sample between HTR4 and schizophrenia. PMID: 19892407
  27. Data shows expression of TNS1, GSTCD, AGER, HTR4, and THSD4 in lung tissue, suggesting potential targets for interventions to alleviate respiratory disease. PMID: 20010834
  28. A computational model of the complex between GR113808 and the 5-HT4 receptor, guided by site-directed mutagenesis and the crystal structure of rhodopsin, was developed. PMID: 11989623
  29. The polymorphisms associated with mood disorder were located within the region encoding the divergent C-terminal tails of the 5-HT(4) receptor. PMID: 12399948
  30. Research reports the activation of the extracellular signal-regulated kinases (ERKs) 1 and 2 (p44 and p42 MAP kinase) through the human serotonin receptors 5-HT(4(b)) and 5-HT(7(a)). PMID: 12446729
  31. Results show overexpression of the 5-HT4 receptor in cisapride-responsive ACTH-independent bilateral macronodular adrenal hyperplasia. PMID: 12519861
  32. A highly significant association between schizophrenia and haplotype A-T (OR = 0.13 [0.03-0.58]) was observed. PMID: 12898568
  33. Our findings suggest a complex regulation of h5-HT4 receptor gene expression, involving distinct promoters and non-coding exons. PMID: 15575821
  34. Secretion of the non-amyloidogenic form of amyloid precursor protein, sAPPalpha, induced by the 5-HT4(e) receptor isoform, was not attributed to a general boost of the constitutive secretory pathway, but rather to its specific effect on alpha-secretase activity. PMID: 15710402
  35. Inhibition of Na+/H+ exchange activity by serotonin is mediated by 5-HT4 receptors in Caco-2 cells. PMID: 15825078
  36. Coexpression of h5-HT4R and beta2-adrenergic receptor (beta2AR) resulted in their heterodimerization. PMID: 15896782
  37. The uncoupling and endocytosis of 5-HT4R require different GRK2 concentrations and involve distinct molecular events. PMID: 15919661
  38. An adenovirus expression system was developed to examine the properties of two human 5-HT4 receptor splice variants, h5-HT4(b) and h5-HT4(d), expressed in adult cardiomyocytes lacking native 5-HT4 receptors. PMID: 15950987
  39. These findings provide the first evidence of differential internalization between the two splice variants, 5-HT(4a) and 5-HT(4b) receptors. PMID: 16209130
  40. Research shows overexpression and different splicing of the 5-HT4 receptor in aldosterone-producing adenoma tissues compared to normal adrenocortical tissue. Isoforms (a) and (b) were not expressed in any APA, but were present in the majority of normal adrenal cortex. PMID: 16322401
  41. These results suggest that the HTR4 gene may play a role in the genetic predisposition to ADHD. PMID: 16563621
  42. Data shows that 5-HT(4) receptor stimulation in primary neurons produced a potent but transient activation of the ERK pathway that is dependent on Src tyrosine kinase but entirely independent of beta-arrestin. PMID: 17377064
  43. This research demonstrates that disulfide bridges between Cys112 and Cys145, located within transmembrane domain 3 and transmembrane domain 4, respectively, are critical for 5-HT(4)R dimer formation. PMID: 17379184
  44. Our results indicate that h5-HT(4(b)) is the dominant cardiac isoform of human 5-HT(4) receptors and its expression is elevated in CAF. PMID: 17418812
  45. Functional activity of 5-HT4 receptors was investigated in children with congenital heart disease. PMID: 17603679
  46. In this review, the pathways regulating either beta- or gamma-secretase may be differentially controlled by 5-HT4 receptor isoforms. PMID: 18322379
  47. In failing human ventricle, 5-HT(4) receptor-mediated positive inotropic response was regulated by PDEs in a manner similar to that in postinfarction rat hearts. 5-HT, PDE3, and PDE4 may have pathophysiological functions in heart failure. PMID: 18846035
  48. 5-HT4 expression is lower in the heart ventricle compared to the atrium. Isoform expression in the atrium and ventricle is similar. A parallel increase in cAMP and the phosphorylation state of regulatory proteins following stimulation with 5-HT occurs in the atrium. PMID: 19002436
  49. When the human 5HT4 receptor was placed under the control of the mouse opsin promoter and an opsin rod outer segment (ROS) targeting sequence, it localized to the ROS of transgenic mouse retina. PMID: 19053287
  50. This paper presents an analysis of the SH3TC2 promoter after identifying a read-through transcript of the SH3TC2 and HTR4 loci. Available data suggests HTR4 is a separate locus with its own promoter, and not the product of a bi-cistronic transcript. PMID: 11716477

Show More

Hide All

Database Links

HGNC: 5299

OMIM: 602164

KEGG: hsa:3360

UniGene: Hs.483773

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Endosome.
Tissue Specificity
Isoform 5-HT4(A) is expressed in ileum, brain, and atrium, but not in the ventricle.

Q&A

What is the basic function of HTR4 in the central nervous system?

HTR4 encodes a member of the serotonin receptor family that stimulates cyclic adenosine monophosphate (cAMP) production and plays an important role in regulating neurotransmitter release in both peripheral and central nervous systems . In the brain, the serotonin system promotes prosocial behavior and correctly assesses social emotional information . The 5-HT4 receptor specifically modulates mood, anxiety, and cognition through its actions on neural circuits .

HTR4 is particularly important for maintaining proper excitability of dentate gyrus granule cells in the hippocampus, with direct implications for mood regulation . The receptor's activation has been linked to fast-acting antidepressant-like effects in preclinical models, highlighting its potential as a therapeutic target .

How many splice variants of human 5-HT4 receptor exist and what are their key differences?

There are at least 11 human HTR4 receptor splice variants that have been identified . These splice variants differ primarily in their C-terminal structures while maintaining identical N-terminal and transmembrane domains. The variations in C-termini significantly influence their functional properties, particularly in their transduction of agonist responses .

Different splice variants demonstrate varying affinities for the same ligands, with studies showing over 10-fold variations in binding affinities . Their expression patterns also differ among tissues, with some variants showing tissue-specific distribution. For example, normal adrenal tissue predominantly expresses 5-HT4(a) and 5-HT4(b) and rarely 5-HT4(d) variants, while this pattern changes in pathological conditions .

How does HTR4 signaling work at the molecular level?

HTR4 primarily couples to G-protein signaling pathways, with different splice variants demonstrating the ability to couple to different G-proteins. The 5-HT4(a) variant couples primarily to Gs proteins, while the 5-HT4(b) variant can couple to both Gi/o and Gs proteins . This differential coupling affects the potency of agonists across the variants.

When activated, HTR4 stimulates cAMP production, leading to downstream signaling cascades that influence neurotransmitter release . The C-terminus regions of different splice variants exert varying torsion forces on the conserved transmembrane loops, potentially causing different steric presentations of the active site to ligands and explaining the functional differences observed .

What are the optimal experimental models for studying HTR4 function?

For studying HTR4 function, researchers can employ several experimental models:

  • Cell culture systems: Human embryonic kidney (HEK) cells or COS cells transfected with different HTR4 splice variants allow for controlled studies of receptor signaling and pharmacology .

  • Genetic mouse models: Cre-dependent 5-HT4R knockout mouse lines enable the investigation of region- and cell-type-specific functions of the receptor . These models are particularly valuable for understanding the role of HTR4 in specific brain circuits.

  • Reporter gene assays: Dual-luciferase reporter gene assays can be used to examine promoter activity and transcriptional regulation of HTR4 .

The selection of an appropriate model depends on the specific research question. For pharmacological studies, cell lines expressing defined receptor variants are ideal, while behavioral studies require in vivo models with targeted genetic manipulations.

How should researchers design experiments to study HTR4 promoter methylation?

When designing experiments to study HTR4 promoter methylation, researchers should consider the following methodological approach:

  • Sample collection and DNA extraction: Obtain peripheral blood or tissue samples and extract high-quality DNA using standardized protocols.

  • Methylation assessment: Utilize quantitative methylation-specific polymerase chain reaction (qMSP) to assess DNA methylation levels . The percentage of methylated reference (PMR) can be used to represent the DNA methylation level.

  • Control for confounding variables: Age is a significant factor affecting HTR4 methylation, showing inverse correlation with methylation levels in certain populations . Researchers should either age-match study groups or use statistical methods like binary logistic regression for adjustment.

  • Gender stratification: Given the significant differences in HTR4 methylation patterns between males and females, gender-stratified analyses are strongly recommended .

  • Functional validation: To understand the functional significance of methylation changes, complement methylation studies with expression analysis and reporter gene assays to confirm regulatory effects .

What considerations are important when selecting antibodies for HTR4 detection?

When selecting antibodies for HTR4 detection, researchers should consider:

  • Splice variant specificity: Given the 11 known human HTR4 splice variants, antibodies should be carefully chosen based on whether pan-HTR4 detection or splice variant-specific detection is required . Check if the antibody epitope is in the conserved region (for pan-detection) or in the variable C-terminus (for variant specificity).

  • Validation: Select antibodies that have been validated for the specific application (Western blot, immunohistochemistry, flow cytometry) and species of interest. Look for publications that have used the antibody in similar experimental settings.

  • Cross-reactivity: Ensure minimal cross-reactivity with other serotonin receptors, particularly 5-HT1A and 5-HT7, which share structural similarities with HTR4.

  • Controls: Always include positive controls (tissues or cells known to express HTR4) and negative controls (knockout tissues or blocking peptides) to validate antibody specificity.

  • Detection method compatibility: Confirm that the antibody is compatible with your detection method and any fixation procedures you plan to use.

What is the evidence linking HTR4 to autism spectrum disorder (ASD)?

Several lines of evidence link HTR4 to autism spectrum disorder:

  • DNA methylation alterations: Studies have demonstrated that the DNA methylation levels of the HTR4 promoter are significantly lower in children with ASD than in healthy children (median PMR: 66.23% vs 94.31%, age-adjusted P = 0.034) . This hypomethylation is particularly pronounced in male ASD cases.

  • Age correlation: There is a significant inverse correlation between age and HTR4 promoter methylation in ASD cases, particularly in males (r = -0.431, P = 0.002), suggesting developmental regulation of the receptor .

  • Serotonin system dysregulation: The serotonin system is broadly implicated in ASD, with elevated peripheral serotonin levels but depleted central nervous system serotonin being consistent findings in autism . As part of this system, HTR4 likely contributes to these imbalances.

  • Chromosomal evidence: A chromosomal breakpoint near the HTR4 gene was found in the genome of a male ASD patient, suggesting potential structural genomic contributions to HTR4 dysfunction in ASD .

  • Gender differences: The pronounced male predominance in ASD (4-5 times higher than females) correlates with the finding that HTR4 promoter hypomethylation is more significant in males, potentially explaining some of the gender disparity in ASD prevalence .

How does HTR4 function relate to mood disorders and anxiety?

HTR4 plays a crucial role in mood regulation and anxiety:

  • Antidepressant-like effects: Activation of HTR4 produces fast-acting antidepressant-like effects in preclinical models, making it a target of interest for novel therapeutic approaches to depression .

  • Region-specific effects: Cell-type specific knockout studies reveal that loss of HTR4 specifically from excitatory neurons of the hippocampus leads to robust antidepressant-like behavioral responses but an elevation in baseline anxiety . This suggests complex, region-specific roles for the receptor in mood regulation.

  • Neuronal excitability: HTR4 is necessary to maintain proper excitability of dentate gyrus granule cells in the hippocampus, a region critical for mood regulation . Alterations in this excitability may contribute to mood disorders.

  • Neurotransmitter modulation: Through its role in regulating neurotransmitter release, HTR4 influences serotonergic, glutamatergic, and GABAergic transmission, all of which are implicated in mood disorders .

  • Splice variant involvement: Different HTR4 splice variants may have distinct roles in mood regulation, with altered expression patterns observed in various psychiatric conditions .

What changes in HTR4 splice variant expression are observed in pathological conditions?

Pathological conditions demonstrate distinctive changes in HTR4 splice variant expression:

These findings highlight the importance of assessing splice variant-specific expression patterns in both normal and diseased tissues, as there is potential to modulate receptor function with splice variant-selective drugs .

How do different HTR4 splice variants affect pharmacological responses?

The pharmacological responses to drugs targeting HTR4 vary significantly across splice variants:

  • Potency differences: Compounds like renzapride show dramatic differences in potency across variants. Renzapride is nearly 20 times more potent at the h5-HT4(d) than at the (g) splice variants in inducing cyclic AMP formation in COS cells .

  • Efficacy variations: Some compounds demonstrate different efficacy profiles depending on the splice variant. For example, renzapride behaves as a full agonist at the h5-HT4(d) variant but only as a partial agonist at the (g) variant .

  • Binding affinity differences: Different splice variants exhibit over 10-fold variations in their affinities for ligands in binding studies . These differences are likely due to conformational changes in the receptor binding pocket influenced by the variable C-termini.

  • G-protein coupling selectivity: The potencies of agonists like 5-methoxytryptamine differ between 5-HT4(a) and 5-HT4(b) splice variants due to their differential coupling to G-proteins. The 5-HT4(a) variant couples only to Gs, while the 5-HT4(b) couples to both Gi/o and Gs proteins .

These pharmacological differences suggest that developing splice variant-selective drugs could provide more targeted therapeutic approaches with potentially fewer side effects.

What is the relationship between HTR4 promoter methylation and gene expression?

The relationship between HTR4 promoter methylation and gene expression demonstrates classic epigenetic regulation patterns:

  • Inverse correlation: Data from The Cancer Genome Atlas (TCGA) demonstrates an inverse correlation between HTR4 expression and HTR4 DNA methylation (r = -0.215, P = 0.002) . This inverse relationship is consistent with the typical silencing effect of promoter methylation on gene expression.

  • Functional confirmation: Dual-luciferase reporter gene assays have shown that the HTR4 promoter fragment (-657 bp to -566 bp) can significantly increase promoter activity (fold change = 2.01, P = 0.0065) . This indicates that this region contains potential regulatory elements that can influence transcription.

  • Developmental regulation: The inverse correlation between age and HTR4 promoter methylation observed in ASD cases (particularly in males) suggests that methylation patterns change throughout development, potentially affecting gene expression at different life stages .

  • Tissue-specific patterns: Different tissues likely exhibit different methylation patterns of the HTR4 promoter, contributing to the tissue-specific expression of HTR4 variants .

Understanding this relationship is crucial for interpreting how alterations in HTR4 methylation, such as those observed in ASD, might translate to functional changes in HTR4 signaling.

What are the most promising methodological approaches for studying HTR4 in specific brain circuits?

For studying HTR4 in specific brain circuits, several advanced methodological approaches show particular promise:

  • Conditional knockout models: Cre-dependent 5-HT4R knockout mouse lines allow for the selective deletion of HTR4 in specific brain regions or cell types, enabling precise dissection of circuit-specific functions . This approach has already revealed distinct roles for HTR4 in hippocampal excitatory neurons.

  • Optogenetic and chemogenetic techniques: Combining HTR4 conditional expression with optogenetic or chemogenetic tools enables temporal control over receptor activity in specific circuits, allowing researchers to establish causal relationships between receptor activity and behavior.

  • Single-cell RNA sequencing: This technique can identify cell populations expressing HTR4 and its various splice variants in different brain regions, providing a high-resolution map of HTR4 distribution across neural circuits.

  • Circuit-specific viral manipulations: Viral vectors expressing Cre recombinase or HTR4 can be injected into specific brain regions to manipulate receptor expression with spatial precision.

  • In vivo calcium imaging: Combining genetic HTR4 manipulations with calcium imaging allows researchers to visualize how HTR4 activity influences neural circuit dynamics in behaving animals.

These approaches, particularly when used in combination, offer powerful tools for understanding how HTR4 functions within specific neural circuits to influence behavior and cognition.

How might HTR4 methylation patterns be developed as biomarkers for neuropsychiatric disorders?

The development of HTR4 methylation patterns as biomarkers for neuropsychiatric disorders offers promising clinical applications:

  • Early detection of ASD risk: Given that hypomethylation of the HTR4 promoter appears to be a potential biomarker for predicting the risk of male ASD , developing standardized methylation assays could enable early identification of at-risk individuals, particularly among males.

  • Biomarker validation process:

    • Initial discovery in case-control studies

    • Validation in larger, diverse cohorts

    • Establishment of normative methylation ranges

    • Development of clinical-grade assays

    • Prospective validation in high-risk populations

  • Gender-specific considerations: Given the significant differences in HTR4 methylation patterns between males and females with ASD, sex-specific reference ranges and interpretation guidelines would be essential .

  • Integration with other biomarkers: Combining HTR4 methylation analysis with other established biomarkers could improve diagnostic accuracy and provide more comprehensive risk profiles.

  • Longitudinal monitoring: Tracking HTR4 methylation changes over time could help monitor disease progression or treatment response, as age-related methylation changes have been observed in ASD cases .

While promising, further research is needed to establish the sensitivity, specificity, and predictive value of HTR4 methylation as a biomarker before clinical implementation.

What are the challenges in developing HTR4 splice variant-selective drugs?

Developing drugs that selectively target specific HTR4 splice variants presents several significant challenges:

  • Structural similarities: The 11 human HTR4 splice variants share identical N-terminal and transmembrane domains, with differences only in their C-termini . This high degree of similarity makes it difficult to achieve selective binding.

  • Binding site conservation: The orthosteric binding site for serotonin is highly conserved across variants, requiring developers to target allosteric sites that may be influenced by the variable C-termini.

  • Functional characterization: Comprehensive pharmacological profiling of compounds across all 11 variants is resource-intensive but necessary to understand selectivity profiles.

  • Expression pattern complexity: Different tissues express different combinations of splice variants, and these patterns can change in disease states . A drug selective for one variant may have unexpected effects in tissues expressing multiple variants.

  • Translational challenges: While in vitro systems can demonstrate variant selectivity, validating these effects in more complex in vivo systems where multiple variants are co-expressed remains challenging.

Despite these challenges, the potential therapeutic advantages of variant-selective drugs – including improved efficacy and reduced side effects – make this an important area for continued research.

How can HTR4 research contribute to developing faster-acting antidepressants?

HTR4 research holds significant promise for developing faster-acting antidepressants:

  • Rapid-onset effects: Activation of HTR4 has been shown to produce fast-acting antidepressant-like effects in preclinical models , contrasting with traditional antidepressants that typically require weeks to achieve full efficacy.

  • Circuit-specific targeting: Research on HTR4 in hippocampal excitatory neurons has revealed that modulating receptor activity in specific circuits can produce antidepressant-like effects . This suggests that targeted HTR4 modulation could provide more precise therapeutic approaches.

  • Combination approaches: Understanding how HTR4 interacts with other neurotransmitter systems could lead to novel combination therapies that leverage synergistic effects to enhance onset speed and efficacy.

  • Biomarker-guided treatment: Research on HTR4 methylation patterns could potentially identify patient subgroups most likely to respond to HTR4-targeted treatments, enabling personalized approaches to depression therapy.

  • Splice variant opportunities: Developing compounds with selectivity for specific HTR4 splice variants could potentially improve the therapeutic index by targeting variants predominantly expressed in brain regions relevant to depression while sparing those in regions mediating side effects .

Continued research on HTR4's role in mood regulation, particularly in specific neural circuits, could substantially advance our ability to develop antidepressants with more rapid onset of action.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.