Recombinant Human 5-hydroxytryptamine receptor 5A (HTR5A)

Shipped with Ice Packs
In Stock

Description

Protein Overview

HTR5A is a Class A GPCR comprising 357 amino acids (aa) in humans, with a multi-pass transmembrane structure . It is encoded by the HTR5A gene (chromosomal location: 7q36.2) and belongs to the serotonin receptor family . Key features include:

  • Ligand Binding: Binds serotonin (5-HT) and ergot alkaloids via conserved residues (e.g., D121[3.32], F301[6.51]) .

  • Signaling Pathways: Couples to G(i)/G(o) proteins, inhibiting adenylate cyclase and activating phosphatidylinositol-calcium pathways .

  • Expression Systems: Recombinant production in wheat germ, HEK293 cells, or in vitro cell-free systems .

CharacteristicHuman HTR5ARodent HTR5A
Amino Acid Length357 aa357 aa
Chromosomal Location7q36.25 13.24 cM (mouse)
G-Protein CouplingG(i)/G(o)G(i)/G(o)
Expression SystemsWheat germ, HEK293, in vitroWheat germ, HEK293, in vitro
ApplicationsELISA, WB, structural studiesElectrophysiology, KO models

Expression and Purification

Recombinant HTR5A is produced with tags (e.g., GST, His) for purification and solubility. Key methods include:

  • Wheat Germ System: Full-length protein (1–357 aa) expressed in vitro, suitable for SDS-PAGE and ELISA .

  • HEK293 Cells: His-tagged variants for structural studies (e.g., cryo-EM) .

  • In Vitro Cell-Free Synthesis: Used for producing untagged or Strep-tagged proteins .

SourceTagPurityApplications
Wheat GermGST>90% (SDS-PAGE)ELISA, WB, antibody screening
HEK293 CellsHis, Myc>80% (Coomassie)Structural biology, binding assays
In Vitro Cell-FreeStrep70–80% (SEC)Functional studies, ligand profiling

Electrophysiological and Functional Studies

Electrophysiological studies in rodent brain slices reveal:

  • Inhibitory Neurotransmission: 5-HT5A activation induces outward K⁺ currents via Kir3 channels, reducing neuronal excitability .

  • Submicromolar Sensitivity: EC₅₀ for 5-HT is ~0.6–0.9 µM, with inward rectification and reversal near K⁺ equilibrium potential .

  • Compensatory Plasticity: Htr5A knockout mice exhibit enhanced 5-HT1A receptor currents, suggesting homeostatic regulation .

Target for Neuropsychiatric Disorders

HTR5A is implicated in:

  • Depression and Schizophrenia: Modulates serotonin signaling and GABAergic/Kir3 channel activity .

  • Neuropathic Pain: 5-HT5A antagonists (e.g., SB-699551) suppress nociceptive signaling .

  • Cognitive Function: Agonists like 5-CT show promnesic effects in preclinical models .

Diagnostic Applications

  • Antibody Development: Recombinant HTR5A serves as an antigen for generating specific antibodies for Western blot (WB) and immunohistochemistry .

  • Ligand Screening: Used in high-throughput assays to identify selective agonists/antagonists .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them during order placement. We will prepare according to your specifications.
Lead Time
Delivery times may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance for an additional fee.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
HTR5A; 5-hydroxytryptamine receptor 5A; 5-HT-5; 5-HT-5A; 5-HT5A; Serotonin receptor 5A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-357
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLL VLATILRVRTFHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIAC DVLCCTASIWNVTAIALDRYWSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFG WGETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVS PISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQRAALMVGILIGVFVLCWIP FFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFKNFFSRQH
Uniprot No.

Target Background

Function
This receptor is one of several for 5-hydroxytryptamine (serotonin), a biogenic hormone acting as a neurotransmitter, hormone, and mitogen. Its activity is mediated by G proteins.
Gene References Into Functions
  1. Studies indicate that TPH1 218A/C and HTR5A 12A/T polymorphisms are not predictive of treatment response in major depression. PMID: 24903772
  2. Childhood anxiousness did not mediate the effects of HTR2A and HTR5A on mood disorders. PMID: 19381154
  3. Variations in the serotonin (5-HT) receptor 5A sequence influence human plasma triglyceride levels. PMID: 20388841
  4. A SNP in the HTR5A gene is associated with increased susceptibility to bipolar disorder in the Bulgarian population. PMID: 19328558
  5. N-glycosylation at the N6 residue is crucial for membrane expression of this 5-HT5A neurotransmitter receptor, which is essential for its function. PMID: 17881091
  6. In Brazilian individuals with the A/A variant of the -1438G/A polymorphism of the 2A receptor gene, the impact of cultural consonance in family life on depressive symptoms over two years was greater compared to those with the G/A or G/G variants. PMID: 18802937
  7. The receptor has been transiently expressed in Cos M6 cells and exhibits a pharmacological profile closely resembling mouse and rat 5-HT5A receptors, displaying high, specific binding for ergotamine and methiothepin. PMID: 7988681

Show More

Hide All

Database Links

HGNC: 5300

OMIM: 601305

KEGG: hsa:3361

STRING: 9606.ENSP00000287907

UniGene: Hs.65791

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the HTR5A receptor and where is it primarily expressed?

The human 5-hydroxytryptamine receptor 5A (HTR5A) is one of 14 serotonin receptor subtypes, first cloned in 1994. It most closely resembles the 5-HT1 receptor in terms of ligand recognition patterns (showing preference for binding methiothepin and ergotamine), Gi/o coupling mechanisms, and presumed inhibitory autoreceptor function in human cortical and hippocampal pyramidal neurons .

HTR5A expression is predominantly confined to neuronal components of the nervous system. Specifically, dense immunolabeling has been observed in the dorsal horn and Onuff's nucleus of the spinal cord, suggesting roles in central motor control, pelvic floor musculature regulation, and nociception . Additionally, significant expression occurs in cortical and hippocampal regions, consistent with its implicated roles in memory processes and psychiatric conditions.

How does HTR5A differ from other serotonin receptor subtypes?

While HTR5A shares structural similarities with other serotonin receptors, particularly the 5-HT1 family, it possesses distinct pharmacological and functional properties:

  • Signaling mechanism: HTR5A primarily couples to Gi/o proteins, resulting in inhibition of adenylyl cyclase and subsequent reduction in cAMP levels .

  • Pharmacological profile: HTR5A has unique ligand binding characteristics, although there is currently a limited repertoire of selective ligands for this receptor subtype .

  • Functional roles: Unlike other serotonin receptors with well-established roles, HTR5A has been implicated in several neurological functions including memory stabilization, response to antidepressants, and nociceptive processing that distinguish it from other receptor subtypes .

  • Research challenges: HTR5A remains among the least characterized serotonin receptors, largely due to the lack of readily available, selective chemical probes .

What are the current challenges in HTR5A research?

Several significant challenges currently limit HTR5A research:

  • Limited selective probes: There are few molecules with adequate selectivity for HTR5A. Currently available antagonists like SB-699551 possess considerable off-target activity (≤1 μM) for many serotonin receptor family members .

  • Lack of selective agonists: While a few modestly selective antagonists have been identified, selective agonists have yet to be described in the literature .

  • Off-target confounding effects: The substantial off-target activities of compounds like SB-699551 and A-843277 (which is not commercially available) frequently confound the interpretation of in vivo studies .

  • Inter-species variation: Significant differences exist in receptor pharmacology between species. For example, SB-699551-A displays inter-species variation in affinity for the 5-ht5a receptor, with relatively low affinity for rodent 5-ht5a receptors (pKi = 6.3), limiting its utility in common rodent research paradigms .

  • Need for matched control probes: The field lacks chemically matched negative control probes with which to control for off-target effects .

How should I design experiments to study HTR5A function?

When designing experiments to study HTR5A function, consider the following methodological approach:

  • Form a clear research question: Define specific aspects of HTR5A function you wish to investigate, considering current knowledge gaps such as its roles in memory stabilization, nociception, or psychiatric disorders .

  • Identify variables: Carefully identify and manage all variables that may affect your experiment :

    • Independent variable: The specific HTR5A-related parameter you're manipulating

    • Dependent variable: The measurable outcome affected by HTR5A activity

    • Extraneous variables: External factors that might influence results but aren't part of your study design

    • Confounding variables: Unmeasured conditions that could affect both independent and dependent variables

  • Create a hypothesis: Develop a testable hypothesis about the relationship between HTR5A activity and your outcome of interest .

  • Consider experimental conditions: Account for the limitations of current HTR5A pharmacological tools by implementing appropriate controls :

    • Use multiple pharmacological tools when possible to cross-validate findings

    • Include controls for off-target effects of compounds like SB-699551

    • Consider genetic approaches (knockout/knockdown) to complement pharmacological studies

  • Organize subject groups: For in vivo studies, carefully select experimental design types (independent measures, matched pairs, or repeated measures) based on your research question .

What pharmacological tools are available for HTR5A research?

The current pharmacological toolkit for HTR5A research is limited but includes:

  • SB-699551: The most commonly used 5-HT5A antagonist, commercially available but with significant limitations. It displays 30-fold selectivity for human 5-HT5A receptor over other 5-HT receptor subtypes, but also affects the serotonin transporter at only 10-fold higher concentrations . Its utility is further limited by inter-species variations in affinity, with particularly low affinity for rodent 5-HT5A receptors .

  • A-843277: Another 5-HT5A antagonist that has been described in the literature but is not commercially available. Like SB-699551, it has substantial off-target activities that can confound the interpretation of in vivo studies .

  • Novel probe sets: Recent structure-based design approaches have identified novel chemical scaffolds with mid-nanomolar affinity for 5-HT5AR and more restricted off-target profiles compared to SB-699551. These include property-matched probe pairs that control for off-target activities .

When using these tools, researchers should:

  • Implement appropriate concentration controls to minimize off-target effects

  • Include negative controls to account for non-specific binding

  • Consider using complementary approaches (e.g., genetic knockout/knockdown) to validate findings

  • Develop or use probe pairs consisting of an active compound and a structurally similar but inactive analog against the targeted receptor to control for off-target effects

How can homology modeling be applied to HTR5A research?

Homology modeling represents a valuable approach for HTR5A research, especially for developing selective ligands and understanding receptor-ligand interactions. The process typically involves:

  • Model generation: Constructing a three-dimensional model of HTR5A based on structurally related proteins with known crystal structures. This may involve using templates from other G protein-coupled receptors, particularly other serotonin receptors with available structures .

  • Model validation and refinement: Validating the homology model through various computational methods and refining it based on known pharmacological data about HTR5A .

  • Virtual screening: Using the validated model to screen large virtual libraries of compounds (>6 million lead-like molecules) to identify potential HTR5A ligands .

  • Iterative optimization: Implementing an iterative cycle of analoging, docking, and pharmacological testing to optimize hit compounds for improved affinity and selectivity .

This approach has successfully identified novel chemical scaffolds with improved selectivity profiles for other understudied receptors like GPR65, GPR68, and MRGPRX2, and has been applied to HTR5A research to develop more selective probe molecules .

What are the current theories regarding HTR5A's role in neurological functions?

Current research implicates HTR5A in several important neurological functions:

  • Circadian rhythm regulation: Studies suggest that 5-HT5A receptors are involved in regulating rodent circadian rhythms, although limited pharmacological tools have complicated interpretation of these findings .

  • Memory processes: Recent studies implicate HTR5A in memory stabilization and in memory deficits associated with forgetting and amnesia .

  • Psychiatric disorders: Evidence suggests HTR5A upregulation and activation of complex Gi signaling cascades are required for the efficacy of selective serotonin reuptake inhibitor (SSRI) antidepressants, indicating a potential role in mood regulation .

  • Pain processing: HTR5A receptors in the dorsal horn of the spinal cord suggest involvement in nociceptive processing. In vivo studies have demonstrated HTR5A contribution to nociceptive processing in both naïve and injured mice .

  • Motor control: Dense immunolabeling in regions like Onuff's nucleus suggests HTR5A modulates central motor control and pelvic floor musculature regulation .

These theoretical roles require further investigation with improved pharmacological tools to fully elucidate the specific contributions of HTR5A to each function.

How can signal transduction pathway analysis enhance HTR5A research?

Signal transduction pathway analysis offers several advantages for advancing HTR5A research:

  • Identification of downstream effectors: HTR5A primarily couples to Gi/o proteins, inhibiting adenylyl cyclase activity. Comprehensive analysis of this signaling pathway can reveal specific downstream targets that mediate the receptor's diverse neurological effects .

  • Biased signaling investigation: Like many GPCRs, HTR5A may exhibit biased signaling, preferentially activating certain pathways over others depending on the ligand. Pathway analysis can identify these biased signaling properties and their functional consequences .

  • Cross-talk identification: Analysis of HTR5A signaling pathways can reveal potential cross-talk with other receptor systems, providing insight into how HTR5A integrates into broader neuronal signaling networks.

  • Therapeutic target identification: Understanding the complete signaling cascade initiated by HTR5A activation can identify novel downstream targets for therapeutic intervention, potentially circumventing the challenges of developing highly selective HTR5A ligands.

  • Functional correlation: Correlating specific signaling events with physiological outcomes can help disambiguate the multifaceted roles of HTR5A in various neurological functions.

Methodologically, these analyses require complementary approaches including phosphoproteomic analysis, BRET/FRET assays to measure protein-protein interactions, and pathway-specific reporter assays.

What strategies can overcome the selectivity challenges in HTR5A research?

Several innovative strategies can help overcome the selectivity challenges that have hampered HTR5A research:

  • Structure-based drug design: Utilizing homology models of HTR5A to guide rational design of selective ligands. This approach has recently yielded novel chemical scaffolds with improved selectivity profiles compared to existing tools like SB-699551 .

  • Development of probe sets: Rather than seeking a single selective compound, developing collections of related compounds (probe sets) that include:

    • Active probes with known HTR5A activity

    • Structurally similar but inactive control compounds

    • Compounds that control for specific off-target activities

  • Orthogonal validation approaches: Combining pharmacological interventions with genetic approaches (CRISPR/Cas9-mediated knockout or knockdown) to validate HTR5A involvement in specific processes.

  • Species-specific considerations: Accounting for inter-species variations in HTR5A pharmacology when designing experiments. For example, recognizing that SB-699551 has reduced affinity for rodent HTR5A receptors compared to human receptors .

  • Multi-method experimental design: Implementing experimental designs that use multiple, complementary methods to investigate HTR5A function, thereby reducing reliance on any single pharmacological tool.

How does HTR5A compare structurally and functionally to other members of the 5-HT receptor family?

HTR5A shares structural and functional similarities with other 5-HT receptors but also possesses unique characteristics:

How should researchers address inter-species variations in HTR5A pharmacology?

Inter-species variations in HTR5A pharmacology present significant challenges for translational research. Researchers should adopt the following strategies:

  • Species-specific pharmacological characterization: Always characterize the pharmacological properties of HTR5A ligands in the specific species being studied. For example, SB-699551-A displays significantly lower affinity for rodent HTR5A receptors (pKi = 6.3) compared to human HTR5A receptors, which limits its utility in common rodent research paradigms .

  • Appropriate dosing adjustments: When using pharmacological tools across species, adjust dosing regimens based on species-specific pharmacokinetic and pharmacodynamic properties.

  • Complementary genetic approaches: Supplement pharmacological studies with genetic approaches (knockout/knockdown) that are less affected by inter-species pharmacological variations.

  • Humanized animal models: Consider using humanized animal models expressing the human HTR5A gene to improve translational relevance when testing compounds with known species selectivity.

  • Cross-species comparative studies: Design studies that explicitly compare HTR5A properties and functions across species to better understand evolutionary conservation and divergence.

  • In vitro validation: Prior to in vivo experiments, validate compound activity in vitro using cell lines expressing the species-specific HTR5A receptor of interest.

What statistical approaches are most appropriate for analyzing HTR5A experimental data?

The choice of statistical approach depends on the specific experimental design and research question, but several considerations are particularly relevant for HTR5A research:

How can researchers distinguish HTR5A-specific effects from off-target actions of available pharmacological tools?

Distinguishing HTR5A-specific effects from off-target actions requires a multi-faceted approach:

  • Use of probe pairs: Implement matched probe pairs consisting of an active compound and a structurally similar but inactive analog against HTR5A. This approach allows researchers to control for off-target effects while isolating HTR5A-specific actions .

  • Concentration-response relationships: Thoroughly characterize concentration-response relationships for both target and off-target effects. HTR5A-specific effects should follow expected potency relationships based on known binding affinities.

  • Competitive antagonism: Use competitive antagonism studies with multiple structurally distinct antagonists. HTR5A-specific effects should be blocked by all selective antagonists despite their different chemical structures and potential different off-target profiles.

  • Genetic validation: Complement pharmacological approaches with genetic knockdown/knockout studies. Effects that persist in HTR5A knockout models are likely due to off-target actions.

  • Molecular selectivity profiling: Characterize the binding profile of compounds across a broad panel of potential off-targets, particularly other serotonin receptors and transporters. SB-699551, for example, affects the serotonin transporter at only 10-fold higher concentrations than its HTR5A effects .

  • Signal transduction fingerprinting: Compare signaling pathway activation patterns between known selective ligands and less selective compounds to identify signature patterns of HTR5A activation versus off-target effects.

What are the most promising approaches for developing new HTR5A-selective ligands?

Several innovative approaches show promise for developing improved HTR5A-selective ligands:

  • Structure-based design: Using homology models of HTR5A to guide iterative molecular docking and empirical testing strategies. This approach has successfully identified novel chemical scaffolds with mid-nanomolar affinity for HTR5A and more restricted off-target profiles compared to existing tools .

  • Fragment-based drug discovery: Starting with small molecular fragments that bind to HTR5A and iteratively growing them to improve potency and selectivity.

  • Biased ligand development: Focusing on ligands that selectively activate specific signaling pathways downstream of HTR5A, potentially achieving functional selectivity even without absolute binding selectivity.

  • Allosteric modulator discovery: Targeting allosteric binding sites unique to HTR5A rather than the orthosteric binding site, which tends to be more conserved across serotonin receptor subtypes.

  • Property-matched probe pairs: Developing sets of compounds that include both active probes and structurally similar inactive controls, allowing researchers to control for off-target activities while isolating HTR5A-specific effects .

  • Virtual screening of large compound libraries: Conducting in silico screening of millions of lead-like molecules against HTR5A models, followed by empirical testing of top candidates .

  • Artificial intelligence approaches: Implementing machine learning and AI-driven approaches to predict structures with improved selectivity profiles based on existing pharmacological data.

What is known about HTR5A's role in neuropathic pain and how can this be further investigated?

HTR5A appears to play a significant role in nociceptive processing, particularly in neuropathic pain conditions:

  • Anatomical evidence: Dense immunolabeling for HTR5A has been observed in the dorsal horn of the spinal cord, a key region for pain processing .

  • Behavioral evidence: Recent in vivo studies have demonstrated HTR5A contribution to nociceptive processing in both naïve and injured mice .

  • Pharmacological validation: Newly developed probe sets for HTR5A have been used to investigate its hypothesized role in neuropathic pain in mouse models .

To further investigate HTR5A's role in neuropathic pain, researchers should consider:

  • Cell-specific studies: Determine which specific neuronal populations express HTR5A in pain pathways using techniques like single-cell RNA sequencing and immunohistochemistry.

  • Circuit-level analysis: Use optogenetic or chemogenetic approaches to selectively manipulate HTR5A-expressing neurons within pain circuits.

  • Mechanistic investigations: Explore the specific signal transduction pathways downstream of HTR5A that mediate its effects on pain processing.

  • Translational models: Test HTR5A-targeted interventions across multiple models of neuropathic pain with different etiologies to determine the breadth of its involvement.

  • Human biomarker studies: Investigate genetic variations in HTR5A and their correlation with pain sensitivity or chronic pain conditions in human populations.

  • Interaction with analgesic drugs: Examine potential interactions between HTR5A modulation and established analgesic medications to identify synergistic approaches.

How might HTR5A function in the context of psychiatric disorders and their treatment?

HTR5A appears to have significant implications for psychiatric disorders and their treatment:

  • Antidepressant efficacy: Evidence suggests that upregulation of HTR5A receptors and activation of a complex Gi signaling cascade are required for the efficacy of selective serotonin reuptake inhibitor (SSRI) antidepressants .

  • Memory processes: HTR5A has been implicated in memory stabilization and memory deficits associated with forgetting and amnesia, suggesting potential roles in cognitive aspects of psychiatric disorders .

  • Interaction with serotonergic system: As part of the broader serotonergic system, HTR5A likely contributes to emotional regulation and mood control, core features affected in many psychiatric conditions.

Future research directions should include:

  • Clinical correlations: Investigation of HTR5A expression, polymorphisms, or epigenetic modifications in psychiatric patient populations compared to controls.

  • Treatment response prediction: Exploration of whether HTR5A genetic variations or expression levels predict response to specific psychiatric medications.

  • Novel therapeutic targets: Development of HTR5A-selective modulators as potential new therapeutic approaches for treatment-resistant depression or other psychiatric conditions.

  • Cognitive enhancement: Investigation of whether selective HTR5A modulation might improve cognitive symptoms in psychiatric disorders or neurodegenerative conditions.

  • Interaction studies: Examination of how HTR5A interacts with other neurotransmitter systems implicated in psychiatric disorders, such as dopamine, glutamate, or GABA systems.

  • Developmental roles: Exploration of HTR5A's potential roles during brain development and implications for neurodevelopmental psychiatric disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.