Recombinant Human Abhydrolase domain-containing protein 13 (ABHD13)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Abhydrolase Domain-Containing Protein 13 (ABHD13)

Recombinant Human Abhydrolase Domain-Containing Protein 13 (ABHD13) is a protein-coding gene in humans . Orthologous to the mouse Abhd13 gene, ABHD13 is associated with diseases such as Williams-Beuren Syndrome and polyneuropathy . It is predicted to enable palmitoyl-(protein) hydrolase activity and participate in protein depalmitoylation and is located in dendrite cytoplasm .

Basic Information of ABHD13

CategoryInformation
Gene NameAbhydrolase Domain Containing 13 (ABHD13)
OrganismHomo sapiens (Human)
Aliases1110065L07Rik
Predicted FunctionPalmitoyl-(protein) hydrolase activity, protein depalmitoylation
Cellular LocationDendrite cytoplasm
Associated DiseasesWilliams-Beuren Syndrome, polyneuropathy

ABHD13 Interactions and Expression

ABHD13 expression can be influenced by various compounds. For example, in rat models, aflatoxin B1 can decrease the methylation of the ABHD13 gene, while titanium dioxide also decreases its methylation . Additionally, certain antirheumatic drugs, as well as compounds like thiram and trichostatin A, have been shown to decrease ABHD13 mRNA expression . Conversely, valproic acid and flutamide can increase ABHD13 mRNA expression .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ABHD13; C13orf6; Protein ABHD13; Alpha/beta hydrolase domain-containing protein 13; Abhydrolase domain-containing protein 13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-337
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
ABHD13
Target Protein Sequence
MEKSWMLWNFVERWLIALASWSWALCRISLLPLIVTFHLYGGIILLLLIFISIAGILYKF QDVLLYFPEQPSSSRLYVPMPTGIPHENIFIRTKDGIRLNLILIRYTGDNSPYSPTIIYF HGNAGNIGHRLPNALLMLVNLKVNLLLVDYRGYGKSEGEASEEGLYLDSEAVLDYVMTRP DLDKTKIFLFGRSLGGAVAIHLASENSHRISAIMVENTFLSIPHMASTLFSFFPMRYLPL WCYKNKFLSYRKISQCRMPSLFISGLSDQLIPPVMMKQLYELSPSRTKRLAIFPDGTHND TWQCQGYFTALEQFIKEVVKSHSPEEMAKTSSNVTII
Uniprot No.

Target Background

Database Links

HGNC: 20293

KEGG: hsa:84945

UniGene: Hs.183528

Protein Families
Serine esterase family
Subcellular Location
Membrane; Single-pass type II membrane protein.

Q&A

What is the structural characterization of human ABHD13?

ABHD13 belongs to the α/β-hydrolase domain family, characterized by a core domain with a specific folding pattern consisting of eight β-sheets connected by α-helices. This structural arrangement creates the catalytic machinery typical of hydrolase enzymes. While the specific crystal structure of ABHD13 has not been fully resolved, comparative analysis with other ABHD family members suggests a conserved catalytic triad (likely consisting of serine, aspartate/glutamate, and histidine) essential for its hydrolytic function .

To investigate ABHD13 structure, researchers typically employ multiple approaches:

  • Homology modeling based on resolved structures of related ABHD proteins

  • Circular dichroism spectroscopy to analyze secondary structure elements

  • Limited proteolysis combined with mass spectrometry to identify domain boundaries

  • AI-driven conformational ensemble generation to predict functional states and binding pockets

The three-dimensional structure prediction is crucial for understanding potential substrate binding sites and designing inhibitors for mechanistic studies.

What expression systems are most effective for producing recombinant human ABHD13?

Several expression systems have been employed for recombinant ABHD13 production, each with distinct advantages depending on research objectives:

Expression SystemAdvantagesLimitationsTypical Yield
E. coliRapid growth, cost-effective, simple genetic manipulationPotential improper folding, lack of post-translational modifications5-15 mg/L
Mammalian cells (HEK293, CHO)Native-like post-translational modifications, proper foldingHigher cost, slower growth, complex media requirements1-5 mg/L
Insect cells (Sf9, High Five)Higher expression levels than mammalian cells, eukaryotic processingModerate cost, different glycosylation patterns2-10 mg/L
Cell-free systemsRapid production, avoids cellular toxicity issuesLower yield, higher cost0.5-2 mg/L

For structural and functional studies, mammalian expression systems are preferred as they provide proper folding and post-translational modifications that may be critical for enzymatic activity. Common optimization strategies include:

  • Codon optimization for the host organism

  • Use of fusion tags (His, GST, MBP) to enhance solubility and facilitate purification

  • Controlled induction and expression temperature adjustment

  • Addition of specific chaperones to assist proper folding

The choice of expression system should align with specific experimental requirements and downstream applications .

How does ABHD13 compare functionally with other members of the ABHD family?

ABHD13 shares core structural features with other ABHD family members but appears to have distinct substrate preferences and tissue distribution patterns:

ABHD Family MemberPrimary SubstratesTissue ExpressionAssociated Functions
ABHD3Phospholipids with medium-chain fatty acidsWidespreadLipid metabolism regulation
ABHD62-arachidonoylglycerol (2-AG)Brain, intestine, adipose tissueEndocannabinoid signaling, metabolic regulation
ABHD11UnknownMitochondriaPotential metabolic functions
ABHD13Predicted lipid substratesBrain, other tissues not fully characterizedNot fully elucidated

While ABHD3 and ABHD6 have been extensively characterized with identified inhibitors and clear roles in lipid metabolism and signaling pathways, ABHD13's precise substrates and physiological functions require further investigation. The enzyme likely participates in specific lipid metabolism pathways based on homology to other family members, but its unique substrate specificity profile distinguishes it functionally .

Researchers investigating ABHD13 should consider comparative studies with better-characterized family members to generate hypotheses about potential substrates and functions.

What are the challenges in developing selective inhibitors for ABHD13?

Developing selective inhibitors for ABHD13 presents several challenges due to the high structural similarity across the ABHD family. Key considerations include:

  • Selectivity over related enzymes: The catalytic domains of ABHD family proteins share significant homology, making it difficult to achieve selectivity. For example, compounds developed for ABHD6 often show cross-reactivity with ABHD3 and other family members .

  • Pharmacophore refinement strategies:

    • Structure-based design focusing on unique binding pocket features

    • Fragment-based screening to identify selective scaffolds

    • Click chemistry approaches to introduce reporter tags for target validation

    • Covalent inhibitor development targeting non-conserved residues near the active site

  • Activity-based protein profiling (ABPP) for selectivity assessment: This technique is essential for determining inhibitor selectivity across the proteome. ABPP using broad-spectrum serine hydrolase probes can reveal cross-reactivity with other ABHD family members and unrelated hydrolases .

  • Common chemical scaffolds with potential for ABHD13 selectivity:

    • Boronate-based compounds (shown to inhibit ABHD3 with selectivity)

    • Piperidyl-1,2,3-triazole urea derivatives (selective for ABHD6)

    • Carbamate-based inhibitors with modified side chains

    • α-ketoheterocycle scaffolds that can be optimized for binding pocket specificity

Researchers should employ competitive ABPP assays in relevant tissue lysates to evaluate selectivity and potency across multiple hydrolases when developing ABHD13-targeted compounds .

What methodologies are most effective for characterizing ABHD13 enzymatic activity?

Characterizing ABHD13 enzymatic activity requires a multi-faceted approach:

  • Substrate identification strategies:

    • Untargeted lipidomics comparing wild-type and ABHD13-knockout/overexpression systems

    • In vitro screening with diverse lipid libraries (phospholipids, monoacylglycerols, lysophospholipids)

    • Activity-based protein profiling with substrate-mimetic probes

    • Computational prediction based on binding pocket analysis

  • Enzymatic assay development:

    • Fluorogenic substrate assays (using artificial substrates with fluorescent leaving groups)

    • LC-MS/MS-based quantification of native substrate turnover

    • Radiometric assays with 14C- or 3H-labeled lipid substrates

    • Coupled enzyme assays measuring released products indirectly

  • Kinetic parameter determination:

    • Progress curve analysis for slow-binding inhibitors

    • Steady-state kinetics to determine Km, kcat, and catalytic efficiency

    • Inhibition modality assessment (competitive, non-competitive, uncompetitive)

  • Environmental factors affecting activity:

    • pH dependence profiling (pH 5.0-9.0)

    • Temperature stability assessment

    • Metal ion dependency/inhibition evaluation

    • Detergent and buffer optimization for membrane-associated activity

For proper evaluation, parallel analysis with other ABHD family members with known substrates serves as essential positive controls. Negative controls should include catalytically inactive mutants (typically serine-to-alanine mutations in the active site) .

How can protein-protein interactions of ABHD13 be effectively mapped in cellular contexts?

Mapping ABHD13 protein-protein interactions requires complementary approaches:

  • Affinity purification-mass spectrometry (AP-MS):

    • Expression of tagged ABHD13 (FLAG, HA, or BioID) in relevant cell types

    • Gentle lysis conditions to preserve native interactions

    • Quantitative comparison between specific pulldown and controls

    • SILAC labeling to differentiate non-specific binders

    • Catalytically inactive mutants as controls to identify substrate-dependent interactions

  • Proximity labeling methods:

    • BioID or TurboID fusion proteins expressed in target cells

    • APEX2-based proximity labeling

    • Spatial and temporal control of labeling reactions

    • Quantitative proteomics to identify labeled interaction partners

  • Validation strategies:

    • Co-immunoprecipitation with endogenous proteins

    • FRET/BRET biosensors for real-time interaction monitoring

    • Fluorescence colocalization studies

    • Mammalian two-hybrid assays

    • Functional validation through siRNA knockdown of interaction partners

  • Interactome analysis:

    • Network analysis to identify functional clusters

    • Comparison with interactomes of related ABHD family members

    • Integration with transcriptomics data from relevant tissue samples

    • Pathway enrichment analysis to identify biological processes

This multi-layered approach helps distinguish between stable complex formation, transient enzymatic interactions, and non-specific associations, providing insights into ABHD13's cellular functions and regulatory mechanisms .

What are the best practices for validating ABHD13 knockout or knockdown models?

Creating and validating ABHD13 knockout or knockdown models requires rigorous validation at multiple levels:

  • Genomic validation:

    • Sequencing confirmation of CRISPR-Cas9 edits

    • Verification of frameshift mutations or large deletions

    • Analysis of potential off-target modifications through whole-genome sequencing

    • Screening for compensatory genomic changes in related genes

  • Transcript level validation:

    • RT-qPCR analysis with primers spanning multiple exons

    • RNA-seq to verify complete loss of properly spliced transcripts

    • Analysis of potential alternatively spliced products

    • Assessment of compensatory changes in related ABHD family members

  • Protein level validation:

    • Western blotting with validated antibodies against different epitopes

    • Mass spectrometry-based proteomics confirmation

    • Activity-based protein profiling using broad-spectrum hydrolase probes

    • Immunofluorescence to verify subcellular localization changes

  • Functional validation:

    • Substrate accumulation analysis via targeted lipidomics

    • Rescue experiments with wild-type and mutant constructs

    • Phenotypic characterization compared to published ABHD family knockout models

    • Cell type-specific validation in relevant tissues

  • Controls to include:

    • Wild-type parental cells/animals

    • Non-targeting gRNA controls for CRISPR studies

    • Scrambled siRNA controls for knockdown studies

    • Isogenic lines with mutations in non-essential genes

This comprehensive validation approach ensures that observed phenotypes are specifically attributable to ABHD13 loss rather than off-target effects or compensatory mechanisms .

What considerations should be taken into account when designing antibodies against ABHD13?

Designing effective antibodies against ABHD13 requires careful epitope selection and validation:

  • Epitope selection strategies:

    • Unique peptide regions not conserved in other ABHD family members

    • Exposed surface regions based on structural predictions

    • Avoiding catalytic domains that may be structurally conserved

    • N- or C-terminal regions that often have greater sequence diversity

    • Consideration of potential post-translational modifications that might mask epitopes

  • Antibody format selection:

    • Polyclonal antibodies for initial detection with multiple epitope recognition

    • Monoclonal antibodies for consistency and specificity

    • Recombinant antibodies (nanobodies, scFvs) for specialized applications

    • Application-specific considerations (Western blot vs. immunoprecipitation vs. immunohistochemistry)

  • Validation requirements:

    • Testing in ABHD13 knockout/knockdown models as negative controls

    • Overexpression systems as positive controls

    • Cross-reactivity assessment with related ABHD proteins

    • Peptide competition assays to confirm epitope specificity

    • Multiple antibody approach targeting different epitopes

  • Common challenges:

    • Cross-reactivity with other ABHD family members due to sequence homology

    • Low expression levels in native tissues requiring signal amplification

    • Potential conformational changes affecting epitope accessibility

    • Species cross-reactivity limitations for translational studies

For optimal results, researchers should develop antibodies against at least two distinct epitopes and validate each through complementary approaches, particularly using genetic knockout models as definitive negative controls .

How can lipidomic analyses be optimized to identify ABHD13 substrates and products?

Optimizing lipidomic analyses for ABHD13 substrate identification requires specialized approaches:

  • Sample preparation considerations:

    • Rapid tissue/cell harvesting with immediate snap-freezing

    • Extraction protocols optimized for diverse lipid classes (Bligh-Dyer, MTBE, or customized methods)

    • Internal standards for each major lipid class

    • Fractionation approaches to reduce ion suppression

    • Parallel processing of wild-type, ABHD13-overexpressing, and ABHD13-knockout samples

  • Analytical platform selection:

    • Untargeted lipidomics using high-resolution mass spectrometry (Q-TOF, Orbitrap)

    • Targeted approaches for candidate substrate verification

    • Ion mobility separation for isomeric lipid discrimination

    • Multiple chromatographic approaches (reverse phase, HILIC, chiral) for comprehensive coverage

    • Data-independent acquisition methods for improved reproducibility

  • Data analysis strategies:

    • Multivariate statistical approaches (PCA, PLS-DA) for pattern recognition

    • Pathway analysis incorporating known lipid metabolism networks

    • Time-course experiments to distinguish primary from secondary effects

    • Flux analysis using stable isotope labeling

    • Integration with transcriptomics data to identify coordinately regulated pathways

  • Validation approaches:

    • In vitro biochemical assays with recombinant ABHD13

    • Stable isotope tracing in cellular systems

    • Pharmacological inhibition correlated with substrate accumulation

    • Comparison with lipidomic profiles of related ABHD family knockouts

This multi-faceted approach can help distinguish direct ABHD13 substrates from secondary metabolic changes resulting from enzyme modulation. Given the involvement of other ABHD family members in lipid metabolism, comparative analysis with ABHD3, ABHD6, and other related enzymes can provide valuable context for understanding ABHD13's specific role .

How should researchers address conflicting results between in vitro and in vivo studies of ABHD13?

Conflicting results between in vitro and in vivo studies of ABHD13 are common challenges that require systematic investigation:

  • Common sources of discrepancies:

    • Artificial substrate preferences in purified enzyme systems versus physiological substrates

    • Absence of important cofactors or protein partners in reconstituted systems

    • Compartmentalization effects present in cells but absent in vitro

    • Compensatory mechanisms activated in vivo but not in simplified systems

    • Species-specific differences in enzyme properties or regulatory networks

  • Reconciliation strategies:

    • Development of increasingly complex in vitro systems (adding cellular membranes, cofactors)

    • Cell-based assays bridging the gap between purified enzymes and whole organisms

    • Tissue-specific conditional knockout models to address developmental compensation

    • Acute pharmacological inhibition compared with genetic deletion

    • Time-course studies to distinguish immediate versus adaptive responses

  • Integrated experimental approach:

    • Parallel analysis across multiple model systems

    • Consistent substrate concentrations and reaction conditions where possible

    • Multi-omics profiling to capture system-wide effects

    • Correlation of enzyme activity measurements with phenotypic outcomes

    • Mathematical modeling to predict and explain discrepancies

  • Reporting and interpretation recommendations:

    • Transparent reporting of all experimental conditions

    • Careful consideration of kinetic parameters versus physiological substrate concentrations

    • Discussion of limitations for each experimental system

    • Integration of findings rather than dismissal of contradictory results

    • Development of testable hypotheses to explain observed differences

By systematically addressing discrepancies rather than focusing exclusively on consistent findings, researchers can gain deeper insights into ABHD13's context-dependent functions and regulatory mechanisms .

What strategies can address the challenge of distinguishing direct versus indirect effects in ABHD13 functional studies?

Distinguishing direct from indirect effects in ABHD13 functional studies requires multiple complementary approaches:

  • Temporal analysis strategies:

    • Acute versus chronic modulation comparison

    • Time-course experiments with high temporal resolution

    • Inducible expression/deletion systems

    • Rapid pharmacological inhibition with selective compounds

    • Pulse-chase experiments to track metabolic conversions

  • Substrate validation hierarchy:

    • Direct in vitro enzyme-substrate reactions with purified components

    • Cell-free systems with native membranes

    • Intact cell assays with exogenous substrate loading

    • Metabolic labeling in cellular systems

    • In vivo tracing studies with isotope-labeled precursors

  • Genetic complementation approaches:

    • Rescue experiments with wild-type versus catalytically inactive mutants

    • Domain-specific mutants to separate enzymatic from potential scaffolding functions

    • Chimeric proteins swapping domains with other ABHD family members

    • Expression level matching to avoid overexpression artifacts

    • Cell type-specific reconstitution in knockout backgrounds

  • Systems biology integration:

    • Network analysis to identify direct interaction partners

    • Causal reasoning algorithms applied to multi-omics datasets

    • Correlation versus causation testing through targeted interventions

    • Comparison with known direct effects of related enzymes

    • Mathematical modeling of metabolic pathways with parameter estimation

This multi-dimensional approach helps establish causal relationships between ABHD13 activity and observed phenotypes, distinguishing primary enzymatic functions from downstream signaling events or compensatory responses .

How can researchers effectively compare and integrate ABHD13 data across different model systems?

Comparing and integrating ABHD13 data across diverse model systems requires careful consideration of several factors:

  • Cross-species comparison framework:

    • Sequence homology analysis focusing on catalytic residues and substrate-binding regions

    • Structural comparison through homology modeling

    • Expression pattern mapping across equivalent tissues

    • Synteny analysis to identify true orthologs versus paralogs

    • Evolutionary rate analysis to identify functionally constrained regions

  • Data normalization strategies:

    • Internal reference standards for each model system

    • Relative quantification against housekeeping genes/proteins

    • Z-score transformation for cross-platform comparability

    • Batch effect correction for multi-site studies

    • Meta-analysis approaches for published dataset integration

  • Functional conservation assessment:

    • Complementation studies (human ABHD13 expression in model organism knockouts)

    • Parallel substrate screening across species

    • Inhibitor sensitivity profiling across orthologs

    • Interaction partner conservation analysis

    • Phenotypic comparison of knockout models

  • Data integration platforms:

    • Knowledge graphs connecting findings across species

    • Pathway-based integration focusing on conserved biological processes

    • Quantitative systems pharmacology models

    • Adverse outcome pathway frameworks linking molecular events to phenotypes

    • Bayesian integration of data with confidence weighting

  • Translational considerations:

    • Physiological differences affecting interpretation (metabolic rates, lifespan)

    • Tissue composition variations between models

    • Developmental timing differences

    • Disease model relevance

    • Pharmacokinetic/pharmacodynamic variations

This structured approach facilitates more reliable extrapolation between model systems and ultimately to human biology, critical for assessing ABHD13 as a potential therapeutic target .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.