Recombinant Human Abhydrolase domain-containing protein 14A (ABHD14A)

Shipped with Ice Packs
In Stock

Description

General Information

Abhydrolase domain-containing protein 14A (ABHD14A) is a protein-coding gene . Regarding associated diseases, the Global Variome shared LOVD database mentions ABHD14A, offering comprehensive data views for the gene, including options for advanced searches . GeneCards™ provides detailed information, including general data, genomic context, transcripts, proteins, expression, interactions, pathways, orthologs, paralogs, and related products .

Function and Classification

ABHD14A belongs to the metabolic serine hydrolase family, a large group of enzymes in mammals that constitute 1–2% of the total proteome . These enzymes use a conserved nucleophilic serine residue in their active site to catalyze various hydrolytic reactions. The serine hydrolase family includes proteases, lipases, esterases, amidases, and transacylases .

ABHD14A vs ABHD14B

Due to high sequence similarity between ABHD14A and ABHD14B, it has been challenging to differentiate and classify these enzymes accurately using bioinformatics studies . A bioinformatics framework is available to help identify a sequence as either ABHD14A or ABHD14B . The framework serves as a resource to assign a given protein sequence to either ABHD14A or ABHD14B . This facilitates a better classification of these enzymes, aiding in assigning functions to them in different organisms .

Prevalence and Conservation

PSI-BLAST searches were performed on reference sequences of human ABHD14A (RefSeq: NP_056222.2, Uniprot: Q9BUJ0) and human ABHD14B (RefSeq: NP_001139786.1, Uniprot: Q96IU4) to determine the prevalence of ABHD14A and ABHD14B protein sequences across organisms .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ABHD14A; UNQ1913/PRO4373; Protein ABHD14A; Alpha/beta hydrolase domain-containing protein 14A; Abhydrolase domain-containing protein 14A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
ABHD14A
Target Protein Sequence
MVGALCGCWFRLGGARPLIPLGPTVVQTSMSRSQVALLGLSLLLMLLLYVGLPGPPEQTS CLWGDPNVTVLAGLTPGNSPIFYREVLPLNQAHRVEVVLLHGKAFNSHTWEQLGTLQLLS QRGYRAVALDLPGFGNSAPSKEASTEAGRAALLERALRDLEVQNAVLVSPSLSGHYALPF LMRGHHQLHGFVPIAPTSTQNYTQEQFWAVKTPTLILYGELDHILARESLRQLRHLPNHS VVKLRNAGHACYLHKPQDFHLVLLAFLDHLP
Uniprot No.

Target Background

Function
Potential role in granule neuron development.
Gene References Into Functions
  1. Identification and characterization of mouse Dorz1, with comparative sequence analysis to a homologous human protein. PMID: 14667578
Database Links

HGNC: 24538

KEGG: hsa:25864

STRING: 9606.ENSP00000273596

UniGene: Hs.534400

Protein Families
AB hydrolase superfamily, ABHD14 family
Subcellular Location
Cytoplasm. Membrane; Single-pass type II membrane protein.

Q&A

What is the structural organization of ABHD14A and how does it differ from other ABHD family members?

ABHD14A belongs to the α/β-hydrolase domain (ABHD) family of proteins, which are characterized by a conserved catalytic triad. Unlike its paralog ABHD14B, ABHD14A possesses distinct structural features:

  • Contains a conserved catalytic triad consisting of Ser-171, Asp-222, and His-249 in human ABHD14A

  • Features a conserved nucleophilic motif (SxSxS within the VLVSPSLSGHY sequence)

  • Notably lacks the acyltransferase motif (HxxxxD) that is present in ABHD14B

  • Uniquely contains an integral membrane domain of approximately 30-40 amino acids forming an anchoring α-helical sequence at the N-terminal region

This structural organization suggests ABHD14A may have membrane-associated functions distinct from the soluble ABHD14B enzyme. When designing experiments targeting ABHD14A, researchers should consider these structural differences, particularly the membrane domain that may affect solubility and purification strategies.

What expression systems and purification strategies are optimal for producing recombinant ABHD14A?

Successful production of recombinant ABHD14A requires consideration of its membrane domain and structural properties:

Expression Systems:

  • HEK293T mammalian expression system has been validated for producing functional ABHD14A with proper post-translational modifications

  • E. coli, yeast, and baculovirus systems have also been employed but may present challenges due to the membrane domain

Purification Strategy:

  • For His-tagged constructs:

    • Initial capture using His-Trap High Performance columns with a 50-500 mM imidazole gradient elution

    • SDS-PAGE analysis to confirm purity of collected fractions

    • Secondary purification via size exclusion chromatography (e.g., HiLoad 16/60 Superdex200)

Buffer Optimization:

  • Recommended storage buffer: 25 mM Tris-HCl (pH 7.3), 100 mM glycine, 10% glycerol

  • Flash freezing in liquid nitrogen with storage at -80°C is advised for long-term stability

Quality Control:

  • Assess purity via SDS-PAGE (target >80% purity)

  • Verify protein concentration using microplate BCA method

  • Confirm identity via western blot with anti-ABHD14A antibodies

The predicted molecular weight of human ABHD14A is 29.6 kDa, which should be considered when analyzing purification results .

How can researchers functionally characterize ABHD14A given its cryptic activity?

Characterizing ABHD14A's function presents challenges due to its unknown enzymatic activity. The following methodological approaches can help elucidate its function:

Activity-Based Protein Profiling (ABPP):

  • Use fluorophosphonate (FP) probes (e.g., FP-rhodamine) that target the active site serine residue

  • Gel-based ABPP assays can report on the nucleophilicity of the active site serine

  • Complementary LC-MS approaches can identify interacting partners

Colorimetric Substrate Hydrolysis Assays:

  • pNP-acetate based colorimetric assays may serve as a potential substrate surrogate

  • Measure hydrolysis activity at 500-second timepoints to ensure linearity

Mutagenesis Studies:

  • Generate alanine mutants of predicted catalytic residues (S171A, D222A, H249A)

  • Compare activities of mutants to wild-type protein to identify essential residues

  • Focus on conserved residues identified from sequence alignment across species

Protein Interaction Studies:

  • Yeast two-hybrid screens to identify protein interactors

  • Co-immunoprecipitation with potential partners based on ABHD14B's known interactions

  • Proximity labeling methods (BioID, APEX) to identify proximal proteins in cellular contexts

A methodical combination of these approaches can help decipher ABHD14A's biological function, particularly in relation to its potential neuronal roles.

What is the evidence linking ABHD14A to Developmental Language Disorder (DLD) and other neurological conditions?

Recent genetic evidence suggests ABHD14A's involvement in neurodevelopmental processes:

Genetic Evidence:

  • Whole-exome sequencing of a Tunisian family with DLD identified multiple ABHD14A variants

  • Four variants were discovered: one rare missense variant (c.689T>G) and three splice-site variants (c.70-8C>T, c.282-25A>T, and c.282-10G>C)

  • The missense variant Leu230Arg significantly affects ABHD14A protein stability and structure

Functional Predictions:

  • Biological function analysis predicts ABHD14A involvement in neuronal development pathways

  • Protein interaction networks suggest connections to pathways critical for language development

Expression Patterns:

  • ABHD14A may play a role in granule neuron development

  • GeneCards data indicates ABHD14A associations with Chanarin-Dorfman Syndrome and Autosomal Recessive Intellectual Developmental Disorder

Methodological Implications:
When investigating ABHD14A's role in neurological disorders, researchers should:

  • Screen for the identified variants in DLD populations

  • Develop functional assays to measure the impact of these variants on protein function

  • Consider animal models (particularly rodents) where ABHD14A is highly conserved

  • Explore potential downstream effects on neuronal development through transcriptomic or proteomic approaches

This emerging evidence positions ABHD14A as a promising target for understanding the molecular basis of specific language impairments.

How can researchers differentiate between ABHD14A and ABHD14B in experimental settings?

Despite sequence similarities, ABHD14A and ABHD14B have distinct characteristics that can be leveraged for experimental differentiation:

Sequence-Based Differentiation:

  • ABHD14A contains the nucleophilic motif (SxSxS within VLVSPSLSGHY)

  • ABHD14B contains both the nucleophilic motif (SxSxS within VVISPSLSGMY) and the acyltransferase motif (HxxxxD within GAGHPCYLDKPE)

  • ABHD14A uniquely possesses an N-terminal membrane domain

Functional Assays:

  • ABHD14B functions as a lysine deacetylase, while ABHD14A lacks this activity

  • pNP-acetate hydrolysis assays will show significantly different activity profiles

  • Activity-based protein profiling with FP-rhodamine can distinguish the proteins based on reactivity patterns

Cellular Localization:

  • ABHD14A is predicted to be an integral membrane component

  • ABHD14B is primarily cytosolic

  • Immunofluorescence microscopy with specific antibodies can visualize these localization differences

Antibody Selection:
Several commercially available antibodies can specifically detect ABHD14A:

  • SAB4501087: Rabbit polyclonal antibody validated for western blot and ELISA

  • HPA038153 and HPA056913: Prestige Antibodies validated for immunofluorescence

These differentiating characteristics are essential for accurate experimental design and interpretation, particularly since automated databases have historically misannotated these enzymes due to their sequence similarity .

What are the most effective strategies for studying ABHD14A variants identified in disease contexts?

To evaluate the functional impact of ABHD14A variants:

Structural Modeling Approaches:

  • Use homology modeling based on known ABHD family structures

  • Molecular dynamics simulations to assess stability changes (as with the Leu230Arg variant)

  • Analyze changes in predicted binding pockets or catalytic sites

Recombinant Expression and Characterization:

  • Generate site-directed mutants matching identified disease variants

  • Compare stability, solubility, and expression levels to wild-type protein

  • Assess subcellular localization changes through fluorescent protein tagging

Enzymatic Activity Evaluation:

  • Develop comparative substrate hydrolysis assays for wild-type and variant proteins

  • Use activity-based protein profiling to measure changes in active site reactivity

  • Thermal shift assays to assess structural stability differences

Cellular Models:

  • CRISPR-Cas9 knock-in of specific variants in neuronal cell lines

  • RNA-seq to identify transcriptional changes caused by variants

  • Proximity labeling to detect altered protein interaction networks

In Vivo Approaches:

  • Generate mouse models with equivalent mutations using CRISPR-Cas9

  • Assess developmental and behavioral phenotypes

  • Evaluate neuronal morphology and circuit formation in model organisms

These methodologies provide a comprehensive framework for understanding how ABHD14A variants contribute to neurodevelopmental disorders like DLD.

How do post-translational modifications affect ABHD14A function and stability?

Evidence suggests post-translational modifications (PTMs) may play crucial roles in regulating ABHD14A:

Predicted PTM Sites:

  • Phosphorylation sites: Functional analyses of the conserved Ser-75 residue suggests phosphorylation may allosterically regulate activity

  • Glycosylation potential: N-linked glycosylation sites may influence protein folding and stability

  • Potential ubiquitination sites that could regulate protein turnover

Methodological Approaches for PTM Analysis:

  • Mass Spectrometry-Based PTM Mapping:

    • Enrichment strategies for phosphopeptides (TiO₂, IMAC)

    • Electron transfer dissociation (ETD) fragmentation for glycopeptide analysis

    • Targeted MRM approaches for quantifying specific modifications

  • Site-Directed Mutagenesis Studies:

    • Generate alanine mutants of predicted PTM sites

    • Compare activity profiles with wild-type protein

    • The S75A mutant showed significantly diminished activity in both gel-based ABPP and pNP-acetate hydrolysis assays

  • Cellular Studies:

    • Use phosphatase inhibitors to observe effects on ABHD14A function

    • Investigate kinases potentially responsible for ABHD14A phosphorylation

    • Monitor protein stability under different cellular conditions

Understanding these PTMs could provide insight into regulatory mechanisms controlling ABHD14A activity in different developmental contexts and disease states.

What are the challenges and solutions in designing specific inhibitors for ABHD14A?

Developing specific ABHD14A inhibitors poses several challenges:

Current Challenges:

  • Limited knowledge of natural substrates and binding sites

  • Structural similarity to ABHD14B and other ABHD family members

  • Presence of membrane domain affecting inhibitor accessibility

  • Unknown physiological function complicating target validation

Methodological Solutions:

  • Structure-Based Design Approaches:

    • Leverage comparative modeling with other ABHD structures

    • Focus on unique features like the membrane domain interface

    • Virtual screening against predicted binding pockets

  • Activity-Based Probe Development:

    • Design probes based on the nucleophilic active site serine

    • Modify existing ABHD inhibitor scaffolds (e.g., carbamates, β-lactones)

    • Test selectivity profiles against a panel of other serine hydrolases

  • Fragment-Based Discovery:

    • Screen fragment libraries against recombinant ABHD14A

    • Use thermal shift assays to identify stabilizing fragments

    • Build larger compounds from validated fragment hits

  • Phenotypic Screening:

    • Develop cellular assays based on ABHD14A's role in neuronal development

    • Screen compound libraries for phenotypic rescue in disease models

    • Validate target engagement with competitive binding assays

These approaches represent a comprehensive strategy for developing selective ABHD14A modulators as both research tools and potential therapeutics for associated conditions like DLD.

How can researchers effectively utilize ABHD14A knockout or knockdown models?

Generating and applying ABHD14A-deficient models requires careful consideration:

Model Generation Strategies:

  • CRISPR-Cas9 Knockout:

    • Design guide RNAs targeting early exons of ABHD14A

    • Validate knockout via genomic sequencing, RT-PCR, and western blotting

    • Consider potential off-target effects through whole-genome sequencing

  • RNA Interference:

    • Available validated siRNA reagents: EMU046621 (mouse ABHD14A) and EHU059971 (human ABHD14A)

    • Design shRNA for stable knockdown using validated sequences

    • Use inducible knockdown systems to study temporal requirements

  • Conditional Knockout Models:

    • Implement Cre-loxP systems for tissue-specific deletion

    • Target neuronal populations to study DLD-related phenotypes

    • Use tamoxifen-inducible systems for temporal control

Phenotypic Analysis:

Analysis TypeTechniquesExpected Outcomes
MolecularRNA-Seq, proteomicsChanges in gene expression profiles, particularly neuronal development pathways
CellularImmunohistochemistry, electrophysiologyAltered neuronal morphology, synaptic function
BehavioralLanguage acquisition tests (animal models), cognitive assessmentsDeficits in vocalization, learning, or memory dependent on model organism

Validation Controls:

  • Include rescue experiments with wild-type ABHD14A to confirm specificity

  • Compare with ABHD14B knockouts to distinguish paralog-specific functions

  • Use multiple independent knockout/knockdown lines to minimize clonal variation effects

These models can provide crucial insights into ABHD14A's physiological role and its contribution to neurodevelopmental disorders.

What are the most sensitive methods for detecting low-abundance ABHD14A in biological samples?

Detecting endogenous ABHD14A presents challenges due to potentially low expression levels:

Enhanced Western Blotting Protocols:

  • Signal amplification using HRP-polymer conjugated secondary antibodies

  • Chemiluminescent substrate optimization (Super Signal West Femto or similar)

  • Sample enrichment through immunoprecipitation prior to western blotting

  • Validated antibodies: SAB4501087 shows good specificity for western blotting

Mass Spectrometry-Based Detection:

  • Targeted Selected Reaction Monitoring (SRM) or Parallel Reaction Monitoring (PRM)

  • Identify unique peptides distinguishing ABHD14A from ABHD14B

  • Sample preparation enrichment through hydrophobic interaction chromatography to capture membrane-associated ABHD14A

  • Internal standard peptides for absolute quantification

Immunohistochemistry Optimization:

  • Signal amplification with tyramide signal amplification (TSA)

  • Antigen retrieval optimization for membrane proteins

  • Prestige Antibodies HPA038153 and HPA056913 have been validated for immunofluorescence

RT-qPCR for Transcript Detection:

  • Design primers spanning unique regions not shared with ABHD14B

  • Digital droplet PCR for absolute quantification of low-abundance transcripts

  • Reference gene selection appropriate for tissue/cell type being studied

These methodologies provide complementary approaches to reliably detect and quantify ABHD14A in various biological contexts, particularly important when studying tissues relevant to language development.

How does ABHD14A potentially interact with other proteins in neuronal development pathways?

Understanding ABHD14A's protein interaction network is critical for elucidating its role in neuronal development:

Predicted Interaction Partners:

  • Developmental Language Disorder studies suggest ABHD14A may interact with MRNIP in neuronal development pathways

  • Based on paralog functions, potential interactions with histone-modifying complexes should be investigated

  • GeneCards data suggests connections to pathways involved in intellectual development

Methodological Approaches for Interaction Studies:

  • Affinity Purification-Mass Spectrometry:

    • Use tagged ABHD14A as bait protein in neuronal cell models

    • Implement SILAC or TMT labeling for quantitative comparison

    • Analyze enriched proteins against appropriate controls

  • Proximity Labeling Techniques:

    • ABHD14A-BioID or APEX2 fusion constructs

    • In situ labeling of proximal proteins in membrane-associated contexts

    • MS identification of biotinylated proteins

  • Co-immunoprecipitation Validation:

    • Validate key interactions identified in high-throughput studies

    • Use reciprocal co-IPs to confirm specificity

    • Include membrane-solubilizing conditions appropriate for ABHD14A

  • Functional Validation:

    • CRISPR knockout/knockdown of potential interaction partners

    • Assess effects on ABHD14A localization, stability, and function

    • Determine if identified mutations in DLD affect these protein interactions

These approaches can help construct an interaction network that explains ABHD14A's role in neuronal development and potentially in language acquisition pathways implicated in DLD.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.