Recombinant Human Abhydrolase domain-containing protein 1 (ABHD1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ABHD1; LABH1; Protein ABHD1; Alpha/beta hydrolase domain-containing protein 1; Abhydrolase domain-containing protein 1; Lung alpha/beta hydrolase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-405
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
ABHD1
Target Protein Sequence
MLSSFLSPQNGTWADTFSLLLALAVALYLGYYWACVLQRPRLVAGPQFLAFLEPHCSITT ETFYPTLWCFEGRLQSIFQVLLQSQPLVLYQSDILQTPDGGQLLLDWAKQPDSSQDPDPT TQPIVLLLPGITGSSQDTYVLHLVNQALRDGYQAVVFNNRGCRGEELRTHRAFCASNTED LETVVNHIKHRYPQAPLLAVGISFGGILVLNHLAQARQAAGLVAALTLSACWDSFETTRS LETPLNSLLFNQPLTAGLCQLVERNRKVIEKVVDIDFVLQARTIRQFDERYTSVAFGYQD CVTYYKAASPRTKIDAIRIPVLYLSAADDPFSPVCALPIQAAQHSPYVALLITARGGHIG FLEGLLPWQHWYMSRLLHQYAKAIFQDPEGLPDLRALLPSEDRNS
Uniprot No.

Target Background

Gene References Into Functions
  1. The mouse ortholog of ABHD1 has been sequenced, and its tissue-specific mRNA expression has been characterized. PMID: 11922611
Database Links

HGNC: 17553

OMIM: 612195

KEGG: hsa:84696

STRING: 9606.ENSP00000326491

UniGene: Hs.375791

Protein Families
AB hydrolase superfamily, AB hydrolase 4 family
Subcellular Location
Membrane; Single-pass type II membrane protein.
Tissue Specificity
Ubiquitously expressed.

Q&A

What is ABHD1 and what is its structural characteristics?

ABHD1 (Abhydrolase domain-containing protein 1) is a member of the α/β hydrolase domain-containing protein family. The human ABHD1 cDNA sequence is 1331 bp with a 33 bp 5'UTR and a short 69 bp 3'UTR containing an ATTAAA polyadenylation signal. The open reading frame encodes a 405 residue protein with a calculated molecular mass of 45,221 Da and an isoelectric point of 5.80 .

The protein contains a predicted amino-terminus transmembrane domain and a central core forming an alpha/beta hydrolase fold, a catalytic domain found in many enzymes including serine proteases. In human ABHD1, the catalytic triad consists of Ser203, Asp329, and His358, which is conserved across members of the prosite UPF0017 family .

How is ABHD1 related to other ABHD family proteins?

Human ABHD1 shares structural features with other ABHD family proteins but has distinct sequence characteristics. It is most closely related to ABHD3 (AAC19155 protein), showing 43% identity and 76% similarity . While sequence identity in the transmembrane domain region is minimal, all three related proteins (ABHD1, ABHD3, and murine ABHD1) possess single predicted amino-terminus transmembrane domains .

The ABHD family represents a diverse group of proteins sharing the alpha/beta hydrolase fold but exhibiting various enzymatic functions. Members of this family, including ABHD1, are being increasingly recognized for their roles in lipid metabolism and cellular homeostasis .

What is the genomic organization of ABHD1?

Human ABHD1 has a unique genomic arrangement as it overlaps with the Sec12/PREB gene in an antisense manner. The genes contain a conserved 42 bp overlap in their 3'UTRs and share a conserved polyadenylation signal sequence (TTTATTAAA/TTTAATAAA) that serves both genes .

What cellular function has been demonstrated for ABHD1?

Recent research using Chlamydomonas as a model system has demonstrated that ABHD1 functions as a lysolipid lipase and plays a key role in lipid droplet (LD) formation . ABHD1 localizes to the LD surface and stimulates LD formation through dual mechanisms:

  • Enzymatic function: ABHD1 hydrolyzes lyso-derivatives of diacylglyceryl-N,N,N-trimethylhomoserine (DGTS), producing a free fatty acid and a glyceryltrimethylhomoserine moiety .

  • Structural function: Beyond its enzymatic activity, ABHD1 appears to have biophysical properties that promote LD budding and emergence .

These findings identify ABHD1 as a novel player in lipid metabolism and cellular energy homeostasis.

How does ABHD1 contribute to lipid droplet biogenesis?

ABHD1's contribution to lipid droplet (LD) biogenesis occurs through a dual mechanism that combines both enzymatic activity and structural properties:

  • Lysolipid lipase activity: Purified recombinant ABHD1 protein hydrolyzes lyso-DGTS (lyso-derivatives of diacylglyceryl-N,N,N-trimethylhomoserine), which are components of the LD hemi-membrane. This enzymatic activity produces free fatty acids and glyceryltrimethylhomoserine moieties, potentially altering local lipid composition to favor LD formation .

  • Biophysical promotion of LD budding: In vitro experiments using droplet-embedded vesicles revealed that ABHD1 promotes LD emergence through distinct biophysical properties independent of its enzymatic function. This suggests ABHD1 may influence membrane curvature or surface tension at sites of LD formation .

Overexpression of ABHD1 in Chlamydomonas induced LD formation and increased triacylglycerol (TAG) content, while knockout mutants showed normal TAG levels but increased lyso-DGTS content in their LDs. These findings suggest ABHD1 is not essential for TAG synthesis but plays a critical role in LD assembly and morphology .

What methodological approaches best characterize ABHD1's dual function?

To comprehensively characterize ABHD1's dual function, researchers should consider the following methodological approaches:

  • For enzymatic activity characterization:

    • Recombinant protein expression and purification from appropriate expression systems

    • In vitro lipase activity assays with purified protein and defined substrates

    • Mass spectrometry analysis to identify reaction products

    • Site-directed mutagenesis of the catalytic triad (Ser203, Asp329, His358) to confirm enzymatic mechanism

  • For structural/biophysical function analysis:

    • In vitro reconstitution systems using droplet-embedded vesicles

    • Microscopy-based assays to visualize LD formation and budding

    • Biophysical measurements of membrane properties in the presence/absence of ABHD1

    • Domain mapping to identify regions responsible for LD association

Recent work with Chlamydomonas successfully combined these approaches to demonstrate that ABHD1's role in LD formation involves both its lipase activity on lyso-DGTS and its distinct biophysical property that facilitates LD emergence .

What implications does the ABHD1-Sec12 genomic overlap have for expression regulation?

The 42 bp overlap in the 3'UTRs of ABHD1 and Sec12 genes, sharing a conserved polyadenylation signal, presents a unique regulatory scenario that requires careful consideration in experimental design:

When designing expression constructs or genetic modification strategies for ABHD1, researchers must consider how alterations might affect Sec12 expression. Similarly, interpretation of knockdown or knockout phenotypes should account for potential effects on the overlapping gene.

How might ABHD1's function in lipid metabolism relate to disease mechanisms?

While direct evidence linking ABHD1 dysfunction to human disease is currently limited, its role in lipid metabolism suggests several potential pathological connections that warrant investigation:

  • Metabolic disorders: As ABHD1 influences lipid droplet formation and TAG content, dysregulation might contribute to conditions involving abnormal lipid storage or metabolism, such as obesity, non-alcoholic fatty liver disease, or lipodystrophies.

  • Neurological conditions: Other ABHD family members (e.g., ABHD12) have established roles in neurological diseases. ABHD12 mutations cause the neurodegenerative disease PHARC (polyneuropathy, hearing loss, ataxia, retinitis pigmentosa, and cataract) . Given the functional similarities within the ABHD family, ABHD1 might also influence neuronal lipid homeostasis.

  • Cancer metabolism: Altered lipid metabolism is a hallmark of cancer cells. ABHD1's role in lipid droplet formation could potentially influence cancer cell survival under metabolic stress conditions.

Research examining ABHD1 expression and genetic variants in these disease contexts could reveal new pathophysiological mechanisms and potential therapeutic targets.

What are recommended approaches for recombinant ABHD1 expression and purification?

Based on approaches used for related proteins like ABHD12, the following protocol is recommended for recombinant human ABHD1 expression and purification:

  • Expression system selection:

    • Mammalian expression systems (HEK293T cells) are preferable for maintaining proper post-translational modifications and folding

    • Alternatively, insect cell systems may be suitable for higher yield while maintaining eukaryotic processing

  • Expression construct design:

    • Include appropriate affinity tags (C-Myc/DDK or His-tag) for purification

    • Consider the transmembrane domain when designing constructs; truncated versions may improve solubility

    • Codon optimization may improve expression levels

  • Purification strategy:

    • Affinity chromatography using anti-DDK or Ni-NTA columns as the initial capture step

    • Follow with conventional chromatography (ion exchange, size exclusion) for higher purity

    • Typical buffer conditions: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, with 10% glycerol to maintain stability

  • Quality control parameters:

    • Purity assessment by SDS-PAGE and Coomassie staining (aim for >80% purity)

    • Concentration determination by microplate BCA method

    • Activity assays using lysolipid substrates to confirm functional integrity

  • Storage considerations:

    • Store at -80°C in buffer containing glycerol to prevent freeze-thaw damage

    • Avoid repeated freeze-thaw cycles to maintain activity

    • For applications in cell culture, filter before use (with acknowledgment of potential protein loss)

How can researchers effectively study ABHD1's role in lipid droplet formation?

To investigate ABHD1's role in lipid droplet formation, researchers should consider a multi-faceted approach:

  • Cellular models:

    • Chlamydomonas has proven effective as a model system

    • Mammalian cell lines with active lipid metabolism (hepatocytes, adipocytes) would be appropriate for human ABHD1 studies

    • Both overexpression and knockout/knockdown approaches should be employed

  • Microscopy techniques:

    • Fluorescence microscopy with lipid droplet-specific dyes (BODIPY, Nile Red)

    • Confocal microscopy for co-localization studies with fluorescently tagged ABHD1

    • Live-cell imaging to capture dynamic aspects of LD formation

    • Super-resolution microscopy for detailed analysis of ABHD1 distribution on LDs

  • Biochemical analyses:

    • Lipidomic profiling to quantify changes in TAG and lysolipid content

    • Subcellular fractionation to isolate and characterize LDs

    • In vitro reconstitution assays using purified components to study LD budding

  • Functional mutant analysis:

    • Catalytic triad mutants to distinguish between enzymatic and structural roles

    • Domain mapping to identify regions responsible for LD association

    • Chimeric proteins to determine specificity determinants

Data from these complementary approaches would provide comprehensive insights into ABHD1's mechanistic role in LD formation, as demonstrated in recent work with Chlamydomonas ABHD1 .

What analytical techniques are optimal for studying ABHD1's enzyme activity?

To comprehensively characterize ABHD1's enzymatic activity as a lysolipid lipase, the following analytical approaches are recommended:

  • Substrate preparation and characterization:

    • Synthesize or purify lyso-DGTS and related lysolipids

    • Confirm substrate purity by thin-layer chromatography (TLC) and mass spectrometry

    • Consider both natural and fluorescent/radioactive labeled substrates

  • Activity assays:

    • Spectrophotometric coupled assays measuring released fatty acids

    • Fluorescence-based assays with reporter substrates

    • Direct measurement of substrate consumption and product formation by HPLC

    • Mass spectrometry to identify specific reaction products

  • Enzyme kinetics determination:

    • Measure initial velocities at varying substrate concentrations

    • Determine Km, Vmax, and catalytic efficiency (kcat/Km)

    • Assess pH and temperature optima

    • Evaluate divalent cation requirements

  • Inhibitor studies:

    • Test general lipase inhibitors

    • Develop specific ABHD1 inhibitors through activity-based protein profiling (ABPP)

    • Conduct structure-activity relationship studies

  • Advanced mechanistic investigations:

    • Use site-directed mutagenesis to confirm the catalytic mechanism

    • Analyze the role of specific residues in substrate binding and catalysis

    • Study substrate specificity across different lysolipid classes

These approaches would provide a comprehensive understanding of ABHD1's enzymatic properties and facilitate comparison with other ABHD family lipases.

What techniques enable effective study of the ABHD1-Sec12 genomic overlap?

The unique genomic arrangement where ABHD1 and Sec12 genes share a 42 bp overlap in their 3'UTRs requires specialized techniques for comprehensive analysis:

  • Transcriptional analysis:

    • Strand-specific RT-PCR to distinguish between ABHD1 and Sec12 transcripts

    • 3' RACE (Rapid Amplification of cDNA Ends) to precisely map polyadenylation sites

    • Northern blotting with strand-specific probes to assess transcript size and abundance

    • RNA-seq with strand information to quantify expression levels

  • Promoter and terminator characterization:

    • Reporter gene assays to assess the activity of both gene promoters

    • Mutational analysis of the shared polyadenylation signal to determine effects on both genes

    • Chromatin immunoprecipitation (ChIP) to study transcription factor binding and RNA polymerase occupancy

  • Regulatory interaction assessment:

    • Overexpression of one gene to examine effects on the antisense partner

    • siRNA knockdown with careful design to target only one gene

    • CRISPR-Cas9 editing to introduce mutations in the overlap region

    • Analysis of double-stranded RNA formation using RNase protection assays

  • Evolutionary and comparative analysis:

    • Comparative genomics to assess conservation of the overlap across species

    • Analysis of sequence constraints in the overlapping region

    • Investigation of co-expression patterns in different tissues and conditions

These approaches would help determine the functional significance of this genomic arrangement and its potential regulatory implications .

How should researchers interpret discrepancies in ABHD1 activity assays?

When encountering discrepancies in ABHD1 activity assays, consider the following systematic approach to interpretation and troubleshooting:

  • Protein quality assessment:

    • Verify protein purity and integrity by SDS-PAGE

    • Confirm the presence of the intact catalytic triad (Ser203, Asp329, His358) if using mutated variants

    • Assess protein aggregation state by size exclusion chromatography or dynamic light scattering

  • Substrate considerations:

    • Confirm substrate purity and identity by analytical methods

    • Consider substrate solubility and presentation (micelles, vesicles, emulsions)

    • Test substrate specificity across multiple lysolipid classes

  • Assay condition variables:

    • Systematically test pH, temperature, and ionic strength effects

    • Evaluate the impact of different detergents or lipid environments

    • Assess potential inhibitors or activators in the reaction mixture

  • Common technical issues and solutions:

    IssuePotential CausesTroubleshooting Approaches
    No detectable activityInactive protein, inappropriate substrateTest positive control enzymes, verify assay functionality with commercial lipases
    Variable activity between preparationsInconsistent purification, freeze-thaw damageStandardize purification protocol, aliquot protein, avoid freeze-thaw cycles
    Activity loss over timeProtein instability, proteolysisAdd protease inhibitors, optimize buffer conditions, check storage conditions
    Non-linear kineticsSubstrate limitation, product inhibitionVary substrate concentration, remove products, ensure initial velocity conditions
  • Biological context considerations:

    • Compare in vitro activity with cellular phenotypes

    • Consider the presence of cofactors or interacting proteins in cellular environments

    • Evaluate activity in the context of lipid droplet membrane composition

By systematically addressing these factors, researchers can resolve discrepancies and obtain reliable data on ABHD1's enzymatic properties.

What controls are essential for validating ABHD1 localization studies?

When conducting ABHD1 localization studies, particularly its association with lipid droplets, the following controls are essential for robust validation:

  • Expression controls:

    • Empty vector controls for transfection/overexpression studies

    • Non-targeting siRNA/shRNA for knockdown experiments

    • Verification of expression levels by Western blot

    • Dose-dependent expression to avoid artifacts from extremely high levels

  • Localization specificity controls:

    • Co-staining with established lipid droplet markers (PLIN family proteins)

    • Lipid-specific dyes (BODIPY, Nile Red) for LD visualization

    • ER markers to distinguish LD surface from associated ER membranes

    • Parallel analysis of other ABHD family proteins with different localizations

  • Tag interference assessment:

    • Comparison of N- and C-terminally tagged constructs

    • Untagged protein detection using specific antibodies if available

    • Small tag variants (HA, FLAG) compared to larger tags (GFP)

    • Split-tag approaches to minimize functional interference

  • Functional validation:

    • Catalytic mutants to assess whether activity affects localization

    • Domain deletion/mutation to identify localization determinants

    • Pharmacological treatments affecting LD formation

    • Nutritional interventions (fatty acid loading, starvation)

  • Method-specific controls:

    MethodEssential Controls
    ImmunofluorescenceSecondary antibody only, peptide competition, knockout/knockdown cells
    Live-cell imagingPhotobleaching controls, non-expressing cells, physiological temperature maintenance
    Subcellular fractionationMarker proteins for different compartments, density gradient controls
    Electron microscopyImmunogold labeling specificity, fixation controls, alternative epitopes

How can researchers distinguish between ABHD1's enzymatic and structural roles?

Distinguishing between ABHD1's enzymatic and structural roles in lipid droplet formation requires a carefully designed experimental approach:

  • Catalytic mutant analysis:

    • Generate point mutations in the catalytic triad (Ser203, Asp329, His358)

    • Verify loss of enzymatic activity in vitro

    • Compare the effects of wild-type and catalytically inactive mutants on LD formation

    • Assess localization patterns of catalytic mutants

  • Domain mapping experiments:

    • Create truncation mutants to identify minimal regions required for LD association

    • Generate chimeric proteins with other ABHD family members

    • Perform alanine-scanning mutagenesis of surface residues

    • Express isolated domains to test for autonomous function

  • In vitro reconstitution approaches:

    • Develop artificial lipid droplet systems with defined composition

    • Compare effects of active enzyme versus heat-inactivated protein

    • Use chemical inhibitors to selectively block enzymatic activity

    • Measure biophysical parameters (surface tension, membrane curvature)

  • Correlation analysis in cellular systems:

    • Quantify LD formation in relation to enzymatic activity levels

    • Perform time-course studies to determine temporal relationship between enzymatic activity and structural changes

    • Use super-resolution microscopy to visualize ABHD1 distribution on LD surface

  • Complementary biochemical assessments:

    • Analyze lipid composition changes caused by wild-type versus catalytically inactive ABHD1

    • Measure lyso-DGTS and DGTS levels in different experimental conditions

    • Assess protein-protein interactions that might mediate structural effects

This multi-faceted approach has proven effective in recent studies that identified ABHD1's dual role in promoting LD formation through both lipase activity on lyso-DGTS and distinct biophysical properties favoring LD budding .

What methodological pitfalls should researchers avoid when studying ABHD1?

Researchers should be aware of several methodological pitfalls when studying ABHD1 to ensure robust and reproducible results:

  • Expression system limitations:

    • Avoid prokaryotic expression systems that may not properly fold transmembrane proteins

    • Be cautious of overexpression artifacts that may cause mislocalization

    • Consider tissue-specific differences in post-translational modifications

    • Validate findings in multiple cell types/models

  • Substrate preparation challenges:

    • Ensure lysolipid substrates are pure and properly characterized

    • Be aware that different substrate presentations (micelles, vesicles) may affect activity

    • Consider the impact of detergents on assay results

    • Use physiologically relevant substrate concentrations

  • Localization study confounders:

    • Differentiate between direct LD association and ER proximity

    • Be aware that fixation can alter LD morphology and protein localization

    • Consider that tags might interfere with transmembrane domain insertion

    • Validate microscopy findings with biochemical fractionation

  • Common technical issues to avoid:

    IssuePrevention Strategy
    Non-specific antibody bindingThorough validation with knockout/knockdown controls
    Freeze-thaw protein degradationSingle-use aliquots, glycerol addition, proper storage
    Interference from overlapping geneCarefully designed genetic modifications, monitoring both genes
    Lipid extraction biasUse methods optimized for diverse lipid classes, internal standards
  • Data interpretation caveats:

    • Avoid confusing correlation with causation in lipid metabolism studies

    • Consider compensatory mechanisms in knockout models

    • Be cautious when extrapolating between species (e.g., Chlamydomonas to humans)

    • Account for cell-type specific differences in lipid metabolism

What are promising approaches for developing ABHD1-specific inhibitors?

Developing specific inhibitors for ABHD1 would provide valuable research tools and potential therapeutic leads. Based on approaches used for other ABHD family proteins, the following strategies are recommended:

  • Activity-based protein profiling (ABPP):

    • Design ABPP probes with electrophilic groups targeting the conserved active-site serine (Ser203)

    • Use competitive ABPP to screen for selective inhibitors

    • Apply ABPP in complex proteomes to assess inhibitor selectivity across the ABHD family

  • Structure-based design approaches:

    • Develop homology models based on related ABHD protein structures

    • Perform virtual screening of compound libraries

    • Design covalent inhibitors targeting the catalytic triad

    • Explore unique binding pockets near the active site

  • Fragment-based drug discovery:

    • Screen fragment libraries for binding to ABHD1

    • Use structure-activity relationships to optimize fragments

    • Employ biophysical methods (thermal shift, SPR) to confirm binding

  • Natural product screening:

    • Evaluate lipase inhibitors from natural sources

    • Test compounds known to inhibit other ABHD family members

    • Assess selectivity profiles across the ABHD family

  • Rational design considerations:

    Target FeatureDesign StrategyPotential Challenges
    Catalytic triadCovalent serine-targeting warheadsSelectivity against other serine hydrolases
    Substrate binding pocketSubstrate mimeticsSpecies differences in binding site
    Unique surface featuresAllosteric inhibitorsIdentifying druggable allosteric sites
    Transmembrane domainMembrane-targeting compoundsAchieving membrane penetration

These approaches would enable the development of selective research tools to further elucidate ABHD1 function and potential therapeutic applications .

What are the most significant unanswered questions regarding ABHD1 biology?

Despite recent advances in understanding ABHD1 function, several significant questions remain unanswered:

  • Physiological substrates and products:

    • What are the predominant natural substrates for human ABHD1 in different tissues?

    • How does substrate preference differ between ABHD1 orthologs across species?

    • What is the physiological significance of the specific products generated?

  • Regulation mechanisms:

    • How is ABHD1 expression regulated across different tissues and conditions?

    • What post-translational modifications affect ABHD1 activity?

    • How does the overlapping genomic arrangement with Sec12 influence regulation?

    • Are there protein-protein interactions that modulate ABHD1 function?

  • Comparative biology:

    • How do ABHD1 functions differ between Chlamydomonas and mammals?

    • What evolutionary adaptations explain functional differences between ABHD family members?

    • Are there species-specific aspects of ABHD1 regulation?

  • Disease relevance:

    • Is ABHD1 dysregulation associated with specific human diseases?

    • Are there genetic variants that affect ABHD1 function?

    • Could ABHD1 modulation have therapeutic potential in metabolic disorders?

  • Structural biology:

    • What is the three-dimensional structure of ABHD1?

    • How does membrane association influence protein conformation?

    • What structural features determine substrate specificity?

Addressing these questions will require multidisciplinary approaches combining biochemistry, cell biology, genetics, and structural biology to fully elucidate ABHD1's role in cellular physiology and potential pathological contexts.

How might ABHD1 research impact broader understanding of lipid metabolism?

ABHD1 research has potential to significantly impact our understanding of lipid metabolism in several key areas:

  • Lipid droplet biogenesis mechanisms:

    • ABHD1's dual role provides insight into how proteins can both enzymatically modify lipids and physically facilitate LD formation

    • Understanding LD assembly mechanisms could inform approaches to modulating lipid storage in metabolic diseases

    • The findings challenge traditional views of LDs as passive storage organelles and highlight their dynamic regulation

  • Lysolipid metabolism regulation:

    • ABHD1's activity on lyso-DGTS expands our understanding of lysolipid processing enzymes

    • This activity might represent a conserved mechanism for regulating membrane lipid composition

    • Further research could reveal novel lipid signaling pathways involving ABHD1 products

  • Integrated lipid homeostasis networks:

    • ABHD1 studies may uncover new connections between lipid droplet dynamics and cellular energy metabolism

    • Investigation of ABHD1 interacting partners could reveal regulatory networks controlling lipid storage

    • Comparative analysis with other ABHD proteins might identify common mechanisms and unique functions

  • Translational research opportunities:

    • Insights from ABHD1 biology could inform therapeutic approaches for disorders of lipid metabolism

    • Understanding LD formation mechanisms might lead to strategies for controlling cellular lipid storage

    • ABHD1 inhibitors could serve as research tools to probe specific aspects of lipid metabolism

  • Methodological advances:

    • The dual function analysis of ABHD1 establishes a paradigm for studying proteins with multiple roles

    • In vitro reconstitution systems developed for ABHD1 studies could be applied to other lipid metabolism proteins

    • Approaches for distinguishing enzymatic and structural functions could benefit research on other multifunctional proteins

These broader impacts highlight why continued research on ABHD1 is valuable beyond understanding this specific protein's function.

What emerging technologies might accelerate ABHD1 research?

Several emerging technologies have particular promise for advancing ABHD1 research:

  • Cryo-electron microscopy and tomography:

    • Determination of ABHD1 structure in membrane environments

    • Visualization of ABHD1 organization on lipid droplet surfaces

    • Structural analysis of ABHD1 in complex with interaction partners

    • Capturing dynamic conformational changes during catalysis

  • Advanced genetic engineering approaches:

    • CRISPR-Cas9 base editing for precise modification of catalytic residues

    • Prime editing for introducing specific mutations without double-strand breaks

    • Genome-wide CRISPR screens to identify ABHD1 functional networks

    • Inducible degradation systems for temporal control of ABHD1 function

  • Advanced imaging technologies:

    • Super-resolution microscopy for detailed analysis of ABHD1 distribution

    • Correlative light and electron microscopy to link function with ultrastructure

    • Live-cell imaging with improved spatiotemporal resolution

    • Single-molecule tracking to analyze ABHD1 dynamics on LDs

  • Multi-omics integration approaches:

    • Combined lipidomics, proteomics, and transcriptomics to understand ABHD1 networks

    • Spatial omics to map ABHD1 activity in tissue contexts

    • Systems biology modeling of lipid metabolism incorporating ABHD1 function

    • Metabolic flux analysis to determine ABHD1's impact on lipid metabolism

  • Novel biochemical and biophysical methods:

    TechnologyApplication to ABHD1 Research
    Microfluidic enzyme assaysHigh-throughput substrate specificity profiling
    Hydrogen-deuterium exchange mass spectrometryMapping protein dynamics and binding interfaces
    Optical tweezers and magnetic manipulationMeasuring forces involved in LD budding
    Artificial intelligence for structure predictionGenerating accurate models of ABHD1 for inhibitor design

These technologies, applied individually or in combination, have the potential to significantly advance our understanding of ABHD1 biology and its roles in lipid metabolism and cellular homeostasis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.