Recombinant Human Abhydrolase domain-containing protein 3 (ABHD3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Abhydrolase Domain-Containing Protein 3 (ABHD3)

Recombinant Human Abhydrolase domain-containing protein 3 (ABHD3), also known as lung α/β-hydrolase 3 (LABH3), is a serine hydrolase enzyme that, in humans, is encoded by the ABHD3 gene . It belongs to the α/β-hydrolase domain (ABHD) superfamily of proteins, a diverse group involved in lipid metabolism, signaling, and regulation . ABHD3 is a 409-amino acid protein with a molecular weight of approximately 46 kDa . It is highly expressed in tissues such as the appendix, colon, gall bladder, lymph nodes, stomach, thyroid, small intestine, and duodenum .

Biochemical Features and Biological Roles

ABHD3 is involved in the catabolism of medium-chain phospholipids, distinguishing it from other known phospholipases . It demonstrates specificity towards phosphatidylcholines (PCs) containing a C14 acyl chain and oxidatively truncated phospholipids . Metabolomic studies have confirmed that ABHD3 inhibition leads to an increase of medium-chain PCs in human cells . ABHD3 displays activity with C5-C8 substrates and oxidatively truncated PCs (oxPCs), such as azPAF (1-hexadecyl-2-azelaoyl-glycerol-3-phosphocholine) .

ABHD3 in Lipid Metabolism

ABHD3 plays a multifaceted role in the catabolism of medium-chain phospholipids, a role distinct from other known phospholipases . It selectively cleaves medium-chain and oxidatively-truncated phospholipids . ABHD3-deficient mice exhibit elevated myristoyl (C14)-phospholipids, including C14-lysophosphatidylcholine, which confirms the physiological relevance of ABHD3's substrate assignments .

Inhibitors of ABHD3

Several compounds have been identified as inhibitors of ABHD3 . These inhibitors can be categorized as follows:

Clinical Significance and Pathological Conditions

ABHD3 is upregulated in several pathological conditions, including human ovarian cancer cell lines exposed to standard treatments . Genome-wide association studies have identified associations between the ABHD3 gene and plasma lipid levels, suggesting a role in lipid-related diseases .

Table Summarizing Key ABHD3 Inhibitors

Inhibitor$$IC_{50}$$ (μM)SelectivityMechanism
β-aminocyano(MIDA)boronate 20.14Selective for ABHD3, >95% blockade at 0.5 μM without affecting 60 other serine hydrolases in SW620 cellsCovalent inhibition via boron atom
N-hydroxyhydantoin carbamate 5 (ABC47)0.1Inhibits ABHD3, ABHD4, ABHD6, HSL, PLA2G7, and CES2Unknown
N-hydroxyhydantoin carbamate 6 (ABC34)7.6Inhibits ABHD3, ABHD4, ABHD6, HSL, PLA2G7, and CES2Unknown
Compound 45N/AComplete inhibition of ABHD10 with few off-targets, near-complete inactivation of ABHD10 at 10 μM and of ACOT1/2 at 100 μM, CPVL inhibition confirmedConversion into corresponding boronic acid is required

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ABHD3; Phospholipase ABHD3; Abhydrolase domain-containing protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-409
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
ABHD3
Target Protein Sequence
MQRLAMDLRMLSRELSLYLEHQVRVGFFGSGVGLSLILGFSVAYAFYYLSSIAKKPQLVT GGESFSRFLQDHCPVVTETYYPTVWCWEGRGQTLLRPFITSKPPVQYRNELIKTADGGQI SLDWFDNDNSTCYMDASTRPTILLLPGLTGTSKESYILHMIHLSEELGYRCVVFNNRGVA GENLLTPRTYCCANTEDLETVIHHVHSLYPSAPFLAAGVSMGGMLLLNYLGKIGSKTPLM AAATFSVGWNTFACSESLEKPLNWLLFNYYLTTCLQSSVNKHRHMFVKQVDMDHVMKAKS IREFDKRFTSVMFGYQTIDDYYTDASPSPRLKSVGIPVLCLNSVDDVFSPSHAIPIETAK QNPNVALVLTSYGGHIGFLEGIWPRQSTYMDRVFKQFVQAMVEHGHELS
Uniprot No.

Target Background

Function

Recombinant Human Abhydrolase domain-containing protein 3 (ABHD3) is a phospholipase potentially involved in phospholipid remodeling. It exhibits preferential phospholipase A1 activity, selectively cleaving myristate (C14)-containing phosphatidylcholines, primarily targeting acyl groups at the sn1 position. Minor phospholipase A2 activity on sn2 acyl groups may also occur. Beyond (C14)-containing phosphatidylcholines, ABHD3 may also act on other medium-chain-containing and oxidatively truncated phospholipids.

Database Links

HGNC: 18718

OMIM: 612197

KEGG: hsa:171586

STRING: 9606.ENSP00000289119

UniGene: Hs.397978

Protein Families
AB hydrolase superfamily, AB hydrolase 4 family
Subcellular Location
Membrane; Single-pass type II membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.