Recombinant Human Acetylcholine receptor subunit epsilon (CHRNE)

Shipped with Ice Packs
In Stock

Description

Functional Role in Neuromuscular Signaling

The ε-subunit replaces the fetal γ-subunit around the 33rd week of gestation, forming the adult nAChR pentamer (2α:1β:1δ:1ε) . This subunit enables high-affinity acetylcholine (ACh) binding and efficient ion channel gating, critical for muscle depolarization and contraction . Mutations in CHRNE disrupt these processes, leading to CMS subtypes characterized by muscle weakness and fatigability .

Clinical Implications: CHRNE Mutations and CMS

Over 90 mutations in CHRNE are linked to CMS, classified into:

  • Low-expressor mutations: Cause primary AChR deficiency (86% of CMS cases) .

  • Kinetic mutations: Alter channel gating, including slow-channel (prolonged openings) and fast-channel (brief openings) syndromes .

Notable Mutations and Effects:

MutationTypeFunctional ImpactCMS Subtype
εR64XNonsenseTruncated ε-subunit; reduced AChR expression AChR Deficiency
εR147LMissenseReduced surface expression; mild kinetic effects Fast-channel CMS
εL221FMissenseProlonged channel openings; increased Ca²⁺ permeability Slow-channel CMS
ε1293insGFrameshiftCommon founder mutation in North African populations; AChR deficiency AChR Deficiency

Research Applications

Recombinant CHRNE is pivotal for:

  • Antibody Development: Monoclonal antibodies (e.g., ab233831) target CHRNE for Western blotting and immunohistochemistry .

  • Mechanistic Studies: Investigating how mutations affect AChR assembly, trafficking, and channel kinetics .

  • Therapeutic Testing: β2-adrenergic agonists (e.g., salbutamol) show efficacy in CMS patients with CHRNE mutations, improving muscle strength by upregulating AChR expression .

Future Directions

Ongoing research focuses on:

  • Gene Therapy: Delivering functional CHRNE to compensate for deficient AChR .

  • Pharmacological Optimization: Identifying drugs that enhance ε-subunit expression or stabilize mutant AChRs .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format readily available in our stock, we are happy to accommodate specific format requirements. Please indicate your preferred format in the order notes, and we will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
We aim to accommodate specified tag types. Please communicate your preferred tag type, and we will prioritize its development.
Synonyms
CHRNE; ACHRE; Acetylcholine receptor subunit epsilon
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-493
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
CHRNE
Target Protein Sequence
KNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNLISLNEKEETLTTSVWIGIDW QDYRLNYSKDDFGGIETLRVPSELVWLPEIVLENNIDGQFGVAYDANVLVYEGGSVTWLP PAIYRSVCAVEVTYFPFDWQNCSLIFRSQTYNAEEVEFTFAVDNDGKTINKIDIDTEAYT ENGEWAIDFCPGVIRRHHGGATDGPGETDVIYSLIIRRKPLFYVINIIVPCVLISGLVLL AYFLPAQAGGQKCTVSINVLLAQTVFLFLIAQKIPETSLSVPLLGRFLIFVMVVATLIVM NCVIVLNVSQRTPTTHAMSPRLRHVLLELLPRLLGSPPPPEAPRAASPPRRASSVGLLLR AEELILKKPRSELVFEGQRHRQGTWTAAFCQSLGAAAPEVRCCVDAVNFVAESTRDQEAT GEEVSDWVRMGNALDNICFWAALVLFSVGSSLIFLGAYFNRVPDLPYAPCIQP
Uniprot No.

Target Background

Function
Following acetylcholine binding, the AChR undergoes a significant conformational change impacting all subunits. This alteration leads to the opening of an ion-conducting channel across the plasma membrane.
Gene References Into Functions
  1. Research has established a pretest probability of 31.9% for the CHRNE c.130dupG mutation in at least one allele of CMS patients. Notably, this percentage remains high (26.4%) even when considering only homozygous patients. The likelihood further increases when analyzing patients with impaired eye movement and improvement of symptoms with pyridostigmine. PMID: 29383513
  2. Specific mutations within COLQ, RAPSN, and CHRNE are prevalent in specific ethnic populations in Israel and should be considered when diagnosing congenital myasthenic syndrome. PMID: 28024842
  3. Mutational analysis of CHRNE identified a homozygous 1293insG, a well-characterized low-expressor receptor mutation associated with both epidermolysis bullosa simplex and congenital myasthenic syndrome. PMID: 21175599
  4. This study introduces a novel mouse model for slow-channel congenital myasthenic syndrome induced by the AChR epsilonL221F mutation. PMID: 22178625
  5. Three siblings exhibit clinical history and examination findings consistent with homozygous CHRNE mutations. The clinical presentation of congenital myasthenia subtypes is variable, highlighting the importance of accurate genotyping for guiding treatment decisions. PMID: 21150643
  6. Targeting nAChR may provide a strategy for reducing neurodegeneration secondary to protein tau hyperphosphorylation. PMID: 21715663
  7. Mutations in the varepsilon subunit influenced the Ca(2+) permeability of AChR-channels, with varepsilon(L269F) increasing P(f) and varepsilon(I257F) decreasing it. PMID: 21470676
  8. This study analyzed symmetry at the extracellular domain-transmembrane domain interface in acetylcholine receptor channel gating. PMID: 20864527
  9. Two binding sites exhibit a roughly 10-fold difference in affinity for ACh in the wild type. The epsilonL221F mutation increases the lower affinity, resulting in more similar affinities between the sites. PMID: 12562900
  10. Exon 7 of CHRNE was found to have a deletion. The entire CHRNE gene, spanning 12 exons and 11 introns, was cloned and expressed in COS cells. PMID: 14532324
  11. Mutations within muscle AChRs are the most common cause of CMS. The majority of these mutations are located within the epsilon-subunit gene, leading to AChR deficiency. PMID: 14592868
  12. AChR epsilon-chain peptides were assessed for their in vitro ability to activate peripheral blood mononuclear leukocytes from myasthenia gravis (MG) patients. MG patient cells were stimulated, while cells from nonmyasthenic subjects did not respond. PMID: 15652413
  13. This study reported a patient with congenital myasthenic syndrome caused by two compound heterozygous mutations in the CHRNE gene. PMID: 16087917
  14. A patient with slow-channel congenital myasthenic syndrome carrying a novel slow-channel mutation (a novel valine to phenylalanine mutation) in the epsilon subunit of the acetylcholine receptor was identified. PMID: 16198106
  15. The intrinsically high Ca2+ permeability of human AChRs likely contributes to the development of endplate myopathy when AChR channel opening events are prolonged due to altered AChR-channel kinetics. PMID: 16527851
  16. The enhanced Ca2+ permeability of mutant receptors overrides the protective effect of desensitization. This, combined with prolonged AChR channel opening events, plays a significant role in slow channel syndromes. PMID: 17272341
  17. Upon AChR activation, GABP recruits the histone acetyl transferase (HAT) p300 on the AChR epsilon subunit promoter. In contrast, it recruits the histone deacetylase HDAC1 when the promoter is not activated. PMID: 17304221
  18. This study reports the first synonymous mutation in CHRNE known to generate a cryptic splice site. mRNA quantification strongly suggests that this mutation is the cause of the disease. PMID: 17363247
  19. The higher abundance of mRNA for the AChR epsilon-subunit compared to other subunits suggests a distinctive role for the AChR epsilon-subunit in autosensitization in MG-associated thymomas, particularly those of type A or AB. PMID: 18657869
  20. These findings strongly support the hypothesis that epsilon1293insG mutations in myasthenic syndrome originate from an ancient single founder event in the North African population. PMID: 19064877
  21. Mutations within the acetylcholine receptor (AChR) epsilon-subunit gene underlying congenital myasthenic syndromes were identified in nine patients (seven kinships) of Dutch origin. PMID: 19544078

Show More

Hide All

Database Links

HGNC: 1966

OMIM: 100725

KEGG: hsa:1145

STRING: 9606.ENSP00000293780

UniGene: Hs.654535

Involvement In Disease
Myasthenic syndrome, congenital, 4A, slow-channel (CMS4A); Myasthenic syndrome, congenital, 4B, fast-channel (CMS4B); Myasthenic syndrome, congenital, 4C, associated with acetylcholine receptor deficiency (CMS4C)
Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Epsilon/CHRNE sub-subfamily
Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.

Q&A

What is the functional role of the epsilon subunit in acetylcholine receptor assembly?

The epsilon subunit plays a critical role in acetylcholine receptor (AChR) assembly and surface expression. Research has demonstrated that this subunit participates in forming assembly intermediates, specifically alpha-epsilon heterodimers, which are essential steps in the complete receptor formation process. Studies comparing mouse and rat epsilon subunits have shown that the mouse variant is approximately 10 times more effective in supporting surface AChR expression when transiently transfected in COS cells, regardless of whether other subunits are from mouse or rat origins . This significant difference in assembly efficiency highlights the epsilon subunit's crucial role in determining successful receptor formation and subsequent membrane expression.

How do researchers identify key functional regions within the CHRNE gene product?

Researchers employ species comparison and site-directed mutagenesis techniques to identify functional regions within the CHRNE gene product. A powerful approach involves comparing functional differences between homologous proteins across species and then using site-directed mutagenesis to pinpoint specific amino acid residues responsible for these differences. For example, investigators have identified that two specific amino acid differences in positions 106 and 115 of the N-terminal domain between rat and mouse epsilon subunits account for their differential efficiency in receptor assembly . This methodological approach allows researchers to systematically identify regions critical for protein function without requiring prior structural knowledge, making it particularly valuable for structure-function studies.

What experimental systems are most appropriate for studying CHRNE function?

Cell-based expression systems, particularly COS cells for transient transfection experiments, have proven effective for studying CHRNE function. These systems allow researchers to introduce various combinations of acetylcholine receptor subunit cDNAs and assess their assembly efficiency and surface expression . For structural studies, researchers often employ more specialized techniques including crystallography or cryo-electron microscopy of purified proteins. When investigating disease-related variants, patient-derived samples provide valuable insights, though these must be complemented with controlled in vitro experiments to establish mechanistic relationships. Each experimental approach offers specific advantages depending on the research question being addressed.

How should researchers design experiments to study CHRNE mutations and their functional consequences?

Experimental design for studying CHRNE mutations should follow a systematic approach combining both in vitro and clinical investigations. For laboratory studies, researchers should:

  • Create site-directed mutants representing clinically relevant variants

  • Express these in appropriate cell systems (such as COS cells)

  • Assess receptor assembly using biochemical techniques (co-immunoprecipitation to detect heterodimer formation)

  • Measure surface expression through methods such as cell-surface biotinylation

  • Evaluate functional consequences using electrophysiological techniques

For clinical investigations, researchers should implement standardized assessment protocols that evaluate multiple manifestations of neuromuscular junction dysfunction, including ocular symptoms, bulbar weakness, and limb muscle strength . This comprehensive approach allows correlation between molecular findings and clinical phenotypes, providing deeper insights into genotype-phenotype relationships.

What statistical approaches are most appropriate for analyzing phenotypic variability in CHRNE-related disorders?

When analyzing phenotypic variability in CHRNE-related disorders, researchers should employ a multi-layered statistical approach that accounts for the complex nature of the data. Based on published studies examining patients with the c.1327delG CHRNE variant, effective statistical methods include:

  • Categorical analysis to classify patients into severity groups based on clinical presentation

  • Non-parametric tests (Mann-Whitney U test) for comparing treatment responses between groups

  • Paired comparisons with appropriate corrections for multiple testing to identify significant differences between severity groups

  • Multivariate analysis to control for confounding factors such as age, gender, and comorbidities

These approaches should be combined with objective clinical measurements rather than relying solely on subjective patient-reported outcomes, as demonstrated in studies using the slurp test to objectively assess bulbar weakness .

How can researchers address the challenge of phenotypic heterogeneity in genetically homogeneous CHRNE mutation carriers?

The significant phenotypic heterogeneity observed in patients carrying identical CHRNE mutations (such as the c.1327delG variant) presents a substantial research challenge. To address this complexity, investigators should implement:

  • Comprehensive phenotyping protocols that assess multiple aspects of disease manifestation (ocular, bulbar, limb, respiratory)

  • Age-stratified analyses to account for potential age-dependent effects on phenotype

  • Investigation of potential genetic modifiers through whole-genome or exome sequencing

  • Evaluation of environmental factors and treatment history that might influence phenotypic expression

  • Longitudinal studies to track intra-individual changes over time

Research has shown that even within a genetically homogeneous cohort of 91 patients carrying the c.1327delG variant, significant clinical variability exists, allowing classification into three distinct phenotypic groups according to disease severity . This observation underscores the need for sophisticated research approaches that can uncover factors beyond the primary mutation that influence disease expression.

How should researchers interpret conflicting data on CHRNE variant pathogenicity?

When faced with conflicting data regarding CHRNE variant pathogenicity, researchers should implement a structured evaluation framework that includes:

  • Assessment of the experimental systems used (cell types, expression methods, functional readouts)

  • Evaluation of study populations (size, genetic background, phenotypic characterization)

  • Consideration of methodological differences that might explain discrepancies

  • Integration of multiple lines of evidence (in vitro functional studies, clinical correlations, evolutionary conservation)

  • Application of established variant interpretation guidelines (such as ACMG criteria)

For example, when evaluating the c.1327delG variant in CHRNE, researchers should consider that phenotypic severity varies significantly even within a homogeneous patient cohort, with patients classifiable into mild, moderate, and severe groups despite sharing the same genetic mutation . This highlights the importance of not over-interpreting single studies and instead synthesizing evidence across multiple investigations.

What approaches can help differentiate causative CHRNE variants from benign polymorphisms?

Differentiating causative CHRNE variants from benign polymorphisms requires a multi-faceted approach:

  • Functional studies that directly assess variant impact on protein expression, assembly, and function

  • Family segregation analysis to determine if the variant co-segregates with disease

  • Population frequency data analysis (variants present at high frequencies in unaffected populations are likely benign)

  • Computational predictive algorithms (though these should be considered supportive rather than definitive)

  • Evaluation of evolutionary conservation across species

  • Integration of clinical phenotype data with molecular findings

The study of naturally occurring species differences, such as the amino acid variations at positions 106 and 115 between rat and mouse epsilon subunits that significantly affect receptor assembly , provides valuable insights into functionally important residues and can help interpret human variants affecting the same or similar regions.

How can researchers meaningfully categorize clinical phenotypes in CHRNE-related disorders?

Meaningful categorization of clinical phenotypes in CHRNE-related disorders should be based on objective, standardized assessments across multiple domains of disease manifestation. Published research demonstrates the effectiveness of a three-tiered classification system:

Disease SeverityNumber of patients (N)Male (N, [% of total number of males for each disease severity group])Female (N, [% of total number of females for each disease severity group])Age (mean±SD), median
Mild4424 [50.0]20 [46.5]23.7 (±12.3), 26
Moderate2616 [33.3]10 [23.3]20.2 (±14.2), 25.5
Severe218 [16.7]13 [30.2]38.8 (±16.7), 27
Total91481004310026.2 (±15.5)

This classification approach incorporates assessment of multiple symptom domains including ocular symptoms (ophthalmoparesis and ptosis), bulbar weakness, axial muscle weakness, proximal and distal muscle weakness, and respiratory function . Importantly, researchers should recognize that certain symptoms (such as ocular manifestations) may show limited variability across severity groups, while others (such as bulbar or proximal muscle weakness) may better differentiate between phenotypic categories.

How should researchers formulate effective research questions when studying CHRNE?

Formulating effective research questions for CHRNE studies requires adherence to the FINER criteria (Feasible, Interesting, Novel, Ethical, and Relevant) while ensuring the question addresses gaps in existing knowledge . When developing research questions focused on CHRNE, researchers should:

  • Clearly define the specific aspect of CHRNE function or pathology being investigated

  • Ensure the question can be answered with available or obtainable resources

  • Frame the question to generate testable hypotheses

  • Consider the PICO framework (Population, Intervention/exposure, Comparison, Outcome)

  • Balance specificity with broader significance to the field

For example, rather than asking "What causes CHRNE-related CMS?" researchers might ask "What specific amino acid residues in the epsilon subunit N-terminal domain influence receptor assembly efficiency, and how do variants at these positions correlate with clinical severity in patients with CHRNE mutations?" This more focused approach leads to clearer study designs and more interpretable results.

What experimental designs are most appropriate for studying genotype-phenotype correlations in CHRNE-related disorders?

When investigating genotype-phenotype correlations in CHRNE-related disorders, researchers should consider implementing:

  • Cross-sectional studies with standardized phenotypic assessments across genetically defined cohorts

  • Longitudinal studies to track phenotypic progression over time within mutation-specific groups

  • Case-control designs comparing functional outcomes between different CHRNE variants

  • Family-based studies examining phenotypic variability among relatives with identical mutations

  • Mixed-methods approaches combining quantitative clinical assessments with qualitative patient-reported outcomes

Researchers must be aware of the limitations inherent in each design. As noted in Campbell and Stanley's work on experimental design, the "intransigency of the environment" often necessitates complex designs due to the experimenter's lack of complete control . This is particularly relevant in rare disease research, where small sample sizes and phenotypic heterogeneity present significant challenges.

How can researchers develop valid outcome measures for CHRNE-related clinical studies?

Developing valid outcome measures for CHRNE-related clinical studies requires a comprehensive approach that captures the multifaceted nature of these disorders. Based on published research, effective outcome measure development should:

  • Incorporate both objective clinical assessments (such as the slurp test for bulbar weakness) and standardized patient-reported measures

  • Ensure outcomes address multiple domains of disease manifestation (ocular, bulbar, limb muscle, respiratory)

  • Validate measures across different patient subgroups (age, gender, disease severity)

  • Include functional measures relevant to daily activities and quality of life

  • Establish clinically meaningful thresholds for significant change

Studies examining c.1327delG CHRNE variant carriers have demonstrated the importance of combining objective clinical tests with patient-reported scales, while noting that subjective measures may not always correlate with objective findings . This highlights the need for comprehensive outcome batteries that capture the full spectrum of disease manifestation.

What emerging technologies show promise for advancing CHRNE research?

Several emerging technologies offer significant potential for advancing CHRNE research:

  • CRISPR-Cas9 gene editing for creating precise disease models and correcting pathogenic variants

  • Single-cell transcriptomics to understand cell-specific effects of CHRNE mutations

  • Advanced imaging techniques for visualizing neuromuscular junction structure and function in vivo

  • Induced pluripotent stem cell (iPSC) models derived from patient samples for personalized disease modeling

  • High-throughput functional screening approaches for variant interpretation

These technologies can help address persistent questions regarding the functional consequences of CHRNE variants and potentially identify new therapeutic targets. For example, CRISPR-Cas9 techniques could be used to create isogenic cell lines differing only in specific CHRNE variants, allowing direct assessment of their functional impact without confounding genetic background effects.

How might machine learning approaches benefit CHRNE variant interpretation?

Machine learning approaches offer several potential benefits for CHRNE variant interpretation:

  • Integration of multiple data types (sequence conservation, structural features, functional assay results) to improve variant classification

  • Pattern recognition across large datasets to identify subtle genotype-phenotype correlations not evident through traditional analysis

  • Prediction of variant effects on protein structure and function based on training with known pathogenic and benign variants

  • Automated literature mining to synthesize published evidence across multiple sources

  • Identification of potential genetic modifiers explaining phenotypic variability within mutation-specific cohorts

What are the most promising therapeutic approaches targeting CHRNE-related pathology?

Current and emerging therapeutic approaches targeting CHRNE-related pathology include:

  • Acetylcholinesterase inhibitors (such as pyridostigmine) to enhance neuromuscular transmission by increasing acetylcholine availability

  • 3,4-diaminopyridine to increase acetylcholine release from nerve terminals

  • Antisense oligonucleotides for splice-modulating therapy in variants affecting RNA processing

  • Gene replacement approaches using viral vectors to deliver functional CHRNE copies

  • Small molecules targeting specific pathogenic mechanisms (such as compounds enhancing read-through of nonsense mutations)

Research indicates that treatment responses vary significantly between patients, even among those with identical mutations . This suggests that personalized approaches accounting for individual factors beyond the primary CHRNE mutation may be necessary for optimal therapeutic outcomes. Future research should focus on identifying biomarkers predictive of treatment response to guide therapy selection.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.