Recombinant Human Acyl-CoA wax alcohol acyltransferase 1 (AWAT1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
AWAT1; DGA2; DGAT2L3; Acyl-CoA wax alcohol acyltransferase 1; Diacylglycerol O-acyltransferase 2-like protein 3; Diacylglycerol acyltransferase 2; Long-chain-alcohol O-fatty-acyltransferase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-328
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
AWAT1
Target Protein Sequence
MAHSKQPSHFQSLMLLQWPLSYLAIFWILQPLFVYLLFTSLWPLPVLYFAWLFLDWKTPE RGGRRSAWVRNWCVWTHIRDYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCTEA TGFSKTFPGITPHLATLSWFFKIPFVREYLMAKGVCSVSQPAINYLLSHGTGNLVGIVVG GVGEALQSVPNTTTLILQKRKGFVRTALQHGAHLVPTFTFGETEVYDQVLFHKDSRMYKF QSCFRRIFGFYCCVFYGQSFCQGSTGLLPYSRPIVTVVGEPLPLPQIEKPSQEMVDKYHA LYMDALHKLFDQHKTHYGCSETQKLFFL
Uniprot No.

Target Background

Function
Acyl-CoA wax alcohol acyltransferase 1 (AWAT1) is an acyltransferase that catalyzes the formation of ester bonds between fatty alcohols and fatty acyl-CoAs, producing wax monoesters. It exhibits a strong preference for decyl alcohol (C10), with reduced activity toward C16 and C18 alcohols. A preference for saturated acyl-CoAs is also observed.
Gene References Into Functions
  1. Analysis of AWAT1 and AWAT2 substrate specificity and differentiation-specific expression pattern. PMID: 15671038
Database Links

HGNC: 23252

OMIM: 300924

KEGG: hsa:158833

STRING: 9606.ENSP00000363645

UniGene: Hs.407641

Protein Families
Diacylglycerol acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Predominantly expressed in skin, where it is limited to the sebaceous gland. Expressed in more mature, centrally located cells just before their rupture and sebum release. Also expressed in all tissues except spleen. Expressed at higher level in thymus, p

Q&A

What is AWAT1 and what is its primary function?

AWAT1 (acyl-CoA wax alcohol acyltransferase 1) belongs to the diacylglycerol acyltransferase family and functions primarily to esterify long chain (wax) alcohols with acyl-CoA-derived fatty acids to produce wax esters . This enzymatic activity plays a central role in lipid metabolism in the skin, with wax esters being particularly enriched in sebum . The protein contains multiple transmembrane domains typical of the DGAT2 family and possesses long-chain-alcohol O-fatty-acyltransferase activity that is essential for the formation of specific lipid classes .

Where is AWAT1 predominantly expressed in humans?

AWAT1 is predominantly expressed in the sebaceous gland of the skin, consistent with its role in sebum production and skin lipid metabolism . This tissue-specific expression pattern supports the enzyme's biological function in producing wax esters that contribute to the skin's barrier properties. While expression is highest in sebaceous glands, lower levels of AWAT1 expression have also been reported in other tissues, including testis, lung, brain, and adipose tissue, suggesting potentially broader physiological roles beyond skin lipid biosynthesis .

What are the common synonyms and alternative designations for AWAT1?

AWAT1 is known by several alternative names and identifiers in scientific literature and databases:

SynonymFull Name
DGAT2L3Diacylglycerol O-acyltransferase 2-like 3
DGA2Diacyl glycerol acyltransferase 2
DGADiacylglycerol acyltransferase
Long-chain-alcohol O-fatty-acyltransferase 1-

These alternative designations reflect the enzyme's relationship to diacylglycerol acyltransferases and its functional activity .

What is the substrate specificity of AWAT1 compared to related enzymes?

AWAT1 demonstrates characteristic substrate specificity that distinguishes it from related enzymes like AWAT2. While both enzymes catalyze the formation of wax esters, they exhibit different preferences for substrates:

AWAT1 preferentially synthesizes (O-acyl)-ω-hydroxy fatty acids and type 1ω wax diesters, as evidenced by the reduction of these specific lipid classes in Awat1 knockout mice . In contrast, AWAT2 shows broader substrate utilization, including retinol (vitamin A) as demonstrated by its acyl-CoA:retinol acyltransferase (ARAT) activity .

These differences in substrate specificity likely explain the distinct but overlapping physiological roles of these enzymes, particularly in tissues where both are expressed .

How does AWAT1 interact with other proteins in lipid metabolism pathways?

While comprehensive protein interaction networks for AWAT1 are still being elucidated, evidence suggests functional relationships with other lipid metabolism enzymes. Most notably, AWAT1 shows functional interactions with AWAT2, as demonstrated by the complementary but distinct phenotypes observed in single and double knockout models .

The interaction between AWAT1 and other proteins can be studied using techniques such as:

  • Co-immunoprecipitation with antibodies against AWAT1 or epitope tags

  • Proximity labeling techniques for capturing transient interactions

  • Yeast two-hybrid screening for binary interactions

  • Mass spectrometry-based approaches following affinity purification

When designing such studies, researchers should consider the membrane-bound nature of AWAT1, which may require specialized detergents for solubilization while preserving protein-protein interactions .

What are the optimal conditions for assaying AWAT1 enzymatic activity in vitro?

For optimal measurement of AWAT1 enzymatic activity in vitro, researchers should consider the following methodological approach:

  • Substrate preparation: Use long-chain alcohols (C16-C24) and acyl-CoAs as substrates

  • Buffer composition: 50 mM Tris-HCl (pH 7.4), 150 mM NaCl, with 1-5 mM MgCl₂

  • Reaction conditions: 37°C for mammalian enzymes, with incubation times of 30-60 minutes

  • Product detection: Liquid chromatography-mass spectrometry (LC-MS) for specific detection of wax esters

  • Essential controls: Include heat-inactivated enzyme controls and substrate-only controls

The assay should be optimized with respect to enzyme concentration, substrate solubilization methods (typically using mild detergents like Triton X-100), and detection sensitivity. Kinetic analyses (Km and Vmax determination) can provide valuable insights into substrate preferences and enzyme efficiency .

What expression systems are most effective for producing recombinant human AWAT1?

Several expression systems have been successfully used for recombinant AWAT1 production, each with distinct advantages:

Expression SystemAdvantagesConsiderations
Mammalian cells (HEK293)Native post-translational modifications, proper foldingHigher cost, longer production time
E. coliCost-effective, high yieldMay require refolding, lacks post-translational modifications
Insect cellsBetter folding than bacteria, moderate yieldMore complex than bacterial systems
Cell-free systemsRapid expression, avoids toxicity issuesLimited post-translational modifications

For mammalian expression, vectors containing strong promoters like CMV are recommended to achieve high expression levels. For bacterial expression, codon optimization is crucial as human and bacterial codon preferences differ significantly . Selection of the appropriate expression system should be guided by the specific experimental requirements, such as whether native conformation or high yield is the priority.

What purification strategies yield the highest purity and activity for recombinant AWAT1?

Effective purification of recombinant AWAT1 typically employs affinity chromatography utilizing fusion tags. The choice of tag and purification strategy significantly impacts yield, purity, and activity:

  • Affinity tags: His, GST, or Fc tags facilitate purification, with His-tagged constructs often showing good yield-to-purity ratios for AWAT1 .

  • Membrane protein considerations: As AWAT1 is a membrane-associated protein, solubilization requires careful selection of detergents that maintain protein folding and activity.

  • Multi-step purification: For highest purity, combine affinity chromatography with size exclusion or ion exchange chromatography.

  • Activity preservation: Include stabilizing agents (glycerol, specific lipids) in purification buffers to maintain enzymatic activity.

What phenotypes are observed in AWAT1 knockout models?

Studies using AWAT1 knockout (KO) mice have revealed several important phenotypes that provide insights into the physiological role of this enzyme:

  • Mild dry eye phenotype: Awat1 KO mice exhibit a mild dry eye condition, less severe than observed in Awat2 KO or double knockout models .

  • Altered meibum lipid composition: Specific meibum lipid classes are reduced in Awat1 KO mice, particularly (O-acyl)-ω-hydroxy fatty acids and type 1ω wax diesters .

  • Functional redundancy: The milder phenotype of Awat1 KO compared to Awat2 KO suggests partial functional compensation by AWAT2, though they clearly have distinct roles .

These observations indicate that while AWAT1 contributes to normal tear film lipid composition and eye surface homeostasis, it may not be as critical as AWAT2 for preventing severe dry eye disease .

How should researchers design knockout experiments to study AWAT1 function?

Researchers planning knockout studies to investigate AWAT1 function should consider these methodological aspects:

  • Gene targeting approach: CRISPR-Cas9 is currently the most efficient method, targeting early exons to ensure complete functional disruption. Guide RNA selection should avoid off-target effects.

  • Verification strategy: Confirm knockout at multiple levels:

    • DNA level (sequencing the targeted region)

    • RNA level (RT-PCR or RNA-seq)

    • Protein level (Western blot with validated antibodies)

  • Phenotypic assessment: Focus on:

    • Skin lipid composition (particularly wax esters)

    • Sebaceous gland morphology and function

    • Meibomian gland function and tear film analysis

    • Dry eye disease parameters (corneal staining, tear production)

  • Control considerations: Generate both heterozygous and homozygous knockouts, and consider double knockouts with AWAT2 to understand functional redundancy .

When analyzing results, researchers should be aware that mild phenotypes may indicate functional compensation by related enzymes, necessitating careful experimental design to detect subtle effects.

What are the most informative techniques for analyzing lipid changes in AWAT1-deficient models?

To comprehensively analyze lipid changes in AWAT1-deficient models, researchers should employ a multi-faceted approach:

  • Lipidomics analysis: Use LC-MS/MS to identify and quantify specific lipid species affected by AWAT1 deficiency, with particular attention to wax esters, (O-acyl)-ω-hydroxy fatty acids, and type 1ω wax diesters .

  • Tissue-specific sampling: Analyze lipids from relevant tissues including:

    • Sebaceous glands

    • Meibomian glands

    • Tear film

    • Skin surface lipids

  • Visualization techniques: Employ specialized staining methods like Oil Red O or Nile Red to visualize lipid accumulation patterns in tissue sections.

  • Functional correlations: Correlate lipid compositional changes with functional parameters such as:

    • Tear film stability

    • Tear evaporation rate

    • Skin barrier function

    • Sebum production rate

This comprehensive analytical approach allows researchers to establish clear relationships between AWAT1 deficiency, specific lipid alterations, and functional consequences .

What is the relationship between AWAT1 function and ocular surface diseases?

AWAT1 plays a significant role in maintaining ocular surface health through its contribution to meibum lipid production. Research with knockout mice has established several important connections between AWAT1 and ocular surface diseases:

  • Dry eye disease: Awat1 knockout mice develop mild dry eye phenotypes, suggesting that AWAT1-dependent lipids contribute to normal tear film function .

  • Meibomian gland dysfunction (MGD): Although less severe than in Awat2 knockouts, Awat1 deficiency contributes to altered meibum composition that may predispose to MGD .

  • Tear film instability: The reduction in specific lipid classes ((O-acyl)-ω-hydroxy fatty acids and type 1ω wax diesters) in Awat1 KO mice likely contributes to increased tear film evaporation and instability .

These findings suggest that AWAT1 function is important for maintaining optimal tear film composition, though its contribution appears less critical than that of AWAT2. The relationship between AWAT1 and ocular surface diseases provides potential therapeutic targets for conditions like dry eye disease .

What potential therapeutic applications exist for modulating AWAT1 activity?

Based on current understanding of AWAT1 function and its role in lipid metabolism, several therapeutic approaches could be developed:

  • Enhanced activity in dry eye disease: Small molecule activators of AWAT1 could potentially increase the production of specific meibum lipids to improve tear film stability in mild dry eye disease .

  • Sebaceous gland disorders: Modulators of AWAT1 activity might be useful in conditions characterized by altered sebum composition, such as certain forms of acne or seborrheic dermatitis .

  • Combination approaches: Targeting both AWAT1 and AWAT2 pathways may provide synergistic benefits in conditions affecting meibomian gland function .

  • Lipid replacement therapy: In cases where AWAT1 function is compromised, topical application of synthetic lipids mimicking AWAT1 products could potentially compensate for deficient natural production .

The development of such therapeutic approaches would require extensive preclinical validation, given the importance of maintaining lipid homeostasis in multiple physiological processes .

How do AWAT1 and AWAT2 differ in terms of function and tissue specificity?

AWAT1 and AWAT2 show distinct but overlapping characteristics that have important implications for their physiological roles:

FeatureAWAT1AWAT2
Primary tissue expressionPredominantly sebaceous glandsSebaceous glands, retinal Müller cells
Substrate preferencesLong-chain alcohols with preference for specific acyl-CoAsBroader substrate range including retinol
ProductsSpecific wax ester subtypes ((O-acyl)-ω-hydroxy fatty acids, type 1ω wax diesters)Wax monoesters, retinyl esters, types 1ω and 2ω wax diesters
Knockout phenotypeMild dry eyeSevere dry eye, meibomian gland dysfunction
Functional compensationPartially compensated by AWAT2Less effectively compensated by AWAT1

These differences explain why Awat2 knockout mice exhibit more severe phenotypes than Awat1 knockouts, while double knockouts show the most profound effects. This comparison illustrates their complementary but non-redundant roles in lipid metabolism .

What are common challenges in expressing functional recombinant AWAT1 and how can they be addressed?

Researchers frequently encounter several challenges when expressing recombinant AWAT1:

ChallengePotential Solutions
Low expression levelsOptimize codon usage for expression system, use stronger promoters, adjust culture conditions and induction parameters
Protein insolubilityExpress in mammalian cells rather than bacteria, use fusion partners that enhance solubility (e.g., MBP, SUMO)
Protein misfoldingReduce expression temperature, co-express with chaperones, include appropriate membrane mimetics
Loss of enzymatic activityAvoid harsh purification conditions, include lipids or mild detergents in buffers, minimize time between purification and assay
AggregationInclude stabilizing agents (glycerol, specific lipids) in purification buffers, avoid freeze-thaw cycles

When troubleshooting expression problems, systematic optimization of expression conditions is essential, testing variables one at a time and validating protein functionality at each step. The membrane-associated nature of AWAT1 makes it particularly challenging to express and purify in active form, requiring careful consideration of detergent selection and buffer composition .

What novel methodologies are being developed to study AWAT1 and related enzymes?

Emerging methodologies for AWAT1 research include:

  • CRISPR-based approaches: Beyond simple knockouts, CRISPR technology enables:

    • Precise point mutations to study structure-function relationships

    • Endogenous tagging for tracking native protein

    • Inducible/conditional knockouts for temporal studies

  • Advanced imaging techniques:

    • Super-resolution microscopy for precise subcellular localization

    • Label-free techniques to visualize lipid products in situ

    • Live-cell imaging to track dynamic enzyme activity

  • Computational methods:

    • Molecular dynamics simulations to predict substrate binding

    • Machine learning approaches to identify potential modulators

    • Systems biology modeling of lipid metabolism networks

  • 3D culture systems:

    • Organoid models of sebaceous glands or meibomian glands

    • Microfluidic systems for studying secretory processes

    • Co-culture systems to investigate tissue interactions

These advanced methodologies offer opportunities to gain deeper insights into AWAT1 function, regulation, and potential therapeutic targeting .

What are the key unanswered questions regarding AWAT1 function?

Despite significant advances in understanding AWAT1, several important questions remain:

  • Regulatory mechanisms: How is AWAT1 expression and activity regulated at transcriptional, post-transcriptional, and post-translational levels?

  • Physiological role beyond skin: What functions does AWAT1 serve in tissues with lower expression levels, such as brain, lung, and adipose tissue?

  • Structure-function relationships: What structural features of AWAT1 determine its substrate specificity compared to related enzymes?

  • Pathological implications: Is AWAT1 dysfunction involved in human diseases beyond its potential role in dry eye disease?

  • Evolutionary significance: Why have two distinct enzymes (AWAT1 and AWAT2) with overlapping functions been maintained throughout mammalian evolution?

Addressing these questions will require interdisciplinary approaches combining biochemistry, structural biology, genetics, and clinical research .

How might comparative studies of AWAT1 across species inform human research?

Comparative studies of AWAT1 across species can provide valuable insights that inform human research:

  • Functional conservation: Determining whether AWAT1 substrate preferences and enzymatic mechanisms are conserved across species can highlight evolutionarily essential functional domains.

  • Adaptive specialization: Identifying species-specific adaptations in AWAT1 function, particularly in animals with specialized skin secretions (e.g., marine mammals, desert-adapted species), may reveal novel applications for human health.

  • Disease models: Naturally occurring AWAT1 variants in other species may provide informative models for human conditions related to altered lipid metabolism.

  • Therapeutic insights: Comparative approaches may identify species with enhanced AWAT1 function that could inform the development of therapeutic AWAT1 modulators.

When designing comparative studies, researchers should employ phylogenetic analysis combined with functional assays to determine if substrate preferences have co-evolved with ecological niches or physiological requirements .

What interdisciplinary approaches might accelerate progress in AWAT1 research?

Accelerating progress in AWAT1 research will likely require interdisciplinary collaboration across several fields:

  • Structural biology and biochemistry: Resolving the three-dimensional structure of AWAT1 would significantly advance understanding of its mechanism and substrate specificity.

  • Clinical research and dermatology: Investigating AWAT1 expression and function in human skin disorders could reveal new therapeutic opportunities.

  • Ophthalmology and tear film research: Further characterization of AWAT1's role in meibomian gland function and tear film stability in humans.

  • Medicinal chemistry and drug discovery: Development of specific modulators of AWAT1 activity for potential therapeutic applications.

  • Computational biology and systems approaches: Modeling AWAT1 within broader lipid metabolism networks to understand systemic effects of altered function.

By bringing together expertise from these diverse fields, researchers can develop more comprehensive understanding of AWAT1 biology and its implications for human health and disease .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.