Recombinant Human Acyl-CoA wax alcohol acyltransferase 2 (AWAT2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
AWAT2; DC4; DGAT2L4; MFAT; WS; Acyl-CoA wax alcohol acyltransferase 2; 11-cis-specific retinyl-ester synthase; 11-cis-RE-synthase; Acyl-CoA retinol O-fatty-acyltransferase; ARAT; Retinol O-fatty-acyltransferase; Diacylglycerol O-acyltransferase 2-like protein 4; Diacylglycerol O-acyltransferase candidate 4; hDC4; Long-chain-alcohol O-fatty-acyltransferase 2; Multifunctional O-acyltransferase; Wax synthase; hWS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-333
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
AWAT2
Target Protein Sequence
MLLPSKKDLKTALDVFAVFQWSFSALLITTTVIAVNLYLVVFTPYWPVTVLILTWLAFDW KTPQRGGRRFTCVRHWRLWKHYSDYFPLKLLKTHDICPSRNYILVCHPHGLFAHGWFGHF ATEASGFSKIFPGITPYILTLGAFFWMPFLREYVMSTGACSVSRSSIDFLLTHKGTGNMV IVVIGGLAECRYSLPGSSTLVLKNRSGFVRMALQHGVPLIPAYAFGETDLYDQHIFTPGG FVNRFQKWFQSMVHIYPCAFYGRGFTKNSWGLLPYSRPVTTIVGEPLPMPKIENPSQEIV AKYHTLYIDALRKLFDQHKTKFGISETQELEII
Uniprot No.

Target Background

Function

Acyltransferase catalyzing ester bond formation between fatty alcohols and fatty acyl-CoAs, producing wax monoesters. It exhibits a preference for medium-chain acyl-CoAs (C12-C16) and fatty alcohols shorter than C20 as acyl donors and acceptors, respectively. It also possesses acyl-CoA retinol acyltransferase (ARAT) activity, catalyzing 11-cis-specific retinyl ester synthesis. It displays greater catalytic efficiency with 11-cis-retinol compared to 9-cis-retinol, 13-cis-retinol, and all-trans-retinol substrates.

Gene References Into Functions
  1. MFAT is a multifunctional acyltransferase with a likely significant role in human skin lipid metabolism. PMID: 16106050
Database Links

HGNC: 23251

OMIM: 300925

KEGG: hsa:158835

STRING: 9606.ENSP00000421172

UniGene: Hs.661507

Protein Families
Diacylglycerol acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in skin, where it is primarily restricted to undifferentiated peripheral sebocytes. Also expressed at lower level in other tissues except pancreas.

Q&A

What is human AWAT2 and what are its primary functions?

Human Acyl-CoA wax alcohol acyltransferase 2 (AWAT2), also commonly known as multifunctional O-acyltransferase (MFAT), is an enzyme that catalyzes the synthesis of wax monoesters in multiple tissues. Originally identified over a decade ago, AWAT2 is primarily known for its role in wax monoester biosynthesis in the skin .

In terms of enzymatic function, human AWAT2 demonstrates notable substrate flexibility, catalyzing esterification reactions using various acyl acceptors:

  • Monoacylglycerols (resulting in diacylglycerol synthesis)

  • Long-chain alcohols (resulting in wax monoester synthesis)

  • All-trans-retinol (resulting in all-trans-retinyl ester synthesis)

Beyond skin biology, AWAT2 plays a critical role in the meibomian glands and retina. In meibomian glands, it catalyzes the synthesis of wax esters that comprise approximately 41% of the total lipids in human meibum . In the retina, AWAT2 demonstrates a specialized function in catalyzing 11-cis-specific retinyl ester synthesis in Müller cells, which contributes to sustained cone vision in daylight conditions .

How is AWAT2 expressed in human and animal tissues?

AWAT2 demonstrates a tissue-specific expression pattern that varies considerably between in vivo and in vitro conditions:

Human Expression Pattern:

  • Highly expressed in human meibomian glands (tissue samples)

  • Not detectable in immortalized human meibomian gland epithelial cells (hMGEC) in culture

  • Predominantly expressed in mature sebocytes of the sebaceous gland in skin

  • Low expression levels reported in testis, lung, brain, and adipose tissue

Animal Model Expression Pattern:

  • Highly expressed in rabbit meibomian glands (tissue samples)

  • Expression is rapidly lost when rabbit meibocytes are cultured, showing a −16.9 log2 fold decrease in primary and passaged rabbit meibomian progenitor cells (rMPCs)

  • Not induced during meibocyte differentiation in culture

  • Highly expressed in rodent skin, particularly in sebocytes

This differential expression between in vivo tissue and cultured cells presents a significant challenge for researchers attempting to study AWAT2 function in cell culture systems.

What analytical methods are used to detect and quantify AWAT2 expression?

Standard molecular biology techniques can be employed to analyze AWAT2 expression at both RNA and protein levels:

RNA Analysis:

  • RNA isolation using commercial kits (e.g., RNeasy Mini Kit)

  • RNA quality assessment via spectrophotometry (e.g., Nanodrop)

  • Reverse transcription to obtain cDNA (e.g., iScript Synthesis kit)

  • Quantitative PCR using appropriate primers

The following primers have been validated for AWAT2 detection:

GeneAccession NumberPrimer Sequence (5' - 3')Product Length
Human AWAT2NG_021246.1F-AAGATATTTCCTGGCATCAC R-CCCCTGTAGACATTACATATTC91 bp
Rabbit AWAT2XM_002720065.3F-TGGTGGTGTTTACGCCCTAC R-GTGTTTCCACAAGCGCCATT128 bp

Protein Analysis:

  • Western blotting using specific antibodies against AWAT2

  • Immunohistochemistry for tissue localization studies

  • Immunofluorescence for cellular localization

How does allosteric modulation affect AWAT2 substrate specificity, particularly regarding retinoid metabolism?

AWAT2 exhibits a remarkable property of regulated substrate specificity through allosteric modulation. Golczak and colleagues demonstrated that the enzyme's specificity can be significantly altered through a ligand-induced structural change mechanism:

  • When 11-cis-retinoids bind to AWAT2 in Müller cells, they induce a conformational change in the enzyme

  • This structural modification enhances the enzyme's efficiency specifically for catalyzing 11-cis-retinol esterification

  • The increased specificity comes at the expense of other retinol isomers (9-cis, 13-cis, and all-trans) that may be present in the cell

  • This preferential activity drives 11-cis-retinyl ester accumulation and flux, which is critical for visual pigment regeneration in cones

This allosteric regulation explains how AWAT2, despite its broad substrate specificity and expression in multiple tissues, can perform a highly specialized function in the cone-specific visual cycle. In tissues lacking 11-cis-retinol (effectively all non-ocular tissues), AWAT2's function would reflect its catalytic activity toward long-chain alcohols or mono- and diacylglycerols .

What are the key differences between AWAT2 and other retinyl ester-forming enzymes (LRAT and DGAT1)?

Three enzymes are known to catalyze retinyl ester formation in vivo, each with distinct characteristics:

EnzymePrimary FunctionTissue DistributionSubstrate SpecificityRole in Retinoid Metabolism
AWAT2Wax monoester synthesisSkin (sebocytes), retina (Müller cells), meibomian glands, low levels in testis, lung, brain, adiposeBroad, but can be enhanced for 11-cis-retinol through allosteric modulationCatalyzes 11-cis-specific retinyl ester synthesis in Müller cells, supporting cone vision
DGAT1Triglyceride formationWidely expressed in many tissuesBroad, possesses ARAT activityProposed role in retinyl ester formation in skin and intestine but not other tissues
LRATRetinoid esterificationRPE, liver, intestine, lung, and most other tissuesHighly specific for retinoidsAccounts for most retinol esterification in the body, especially in the RPE

AWAT2 is unique among these enzymes due to its allosteric regulation by 11-cis-retinoids, which directs its activity specifically toward 11-cis-retinol in ocular tissues. Unlike LRAT, which is highly specific for retinoids, AWAT2 has broader substrate specificity but can adopt a more targeted function in specific cellular contexts .

What is the role of AWAT2 in the cone-specific visual cycle and how does it differ from the rod-specific cycle?

AWAT2 plays a critical role in the cone-specific visual cycle, which differs significantly from the rod-specific cycle:

Cone-Specific Visual Cycle (Involving AWAT2):

  • Occurs between cone photoreceptors and Müller cells in the retina

  • All-trans-retinol undergoes enzyme-catalyzed isomerization to 11-cis-retinol in Müller cells via dihydroceramide desaturase-1 (DES-1)

  • 11-cis-retinol can either:

    • Transfer to cones where it's oxidized to 11-cis-retinaldehyde for visual pigment formation

    • Undergo AWAT2-catalyzed esterification to 11-cis-retinyl ester for storage in Müller cells

  • AWAT2's specificity for 11-cis-retinol is enhanced through allosteric modulation

  • This pathway enables rapid dark adaptation and operation in bright light without saturation

Rod-Specific Visual Cycle:

  • Occurs between rod photoreceptors and retinal pigmented epithelial (RPE) cells

  • LRAT (not AWAT2) in RPE cells catalyzes the formation of all-trans-retinyl esters

  • These esters are either stored or converted to 11-cis-retinol through RPE65 isomerohydrolase activity

  • The process is generally slower than the cone-specific cycle

The distinction between these pathways is functionally significant for vision. Cones dark-adapt faster than rods and can operate in bright light without saturating, suggesting that the rate of visual chromophore delivery to cones must be much greater than to rods. This requires mechanisms within Müller cells for rapid mobilization of 11-cis-retinoids during light exposure, a process in which AWAT2 plays a crucial role .

What are the key challenges in designing cell culture models for studying AWAT2 function?

Current cell culture models present significant limitations for studying AWAT2 function, as highlighted by several research findings:

  • Loss of expression in culture:

    • AWAT2 expression is lost in cultured rabbit meibocytes (−16.9 log2 fold decrease)

    • Human meibomian gland epithelial cells (hMGEC) in culture show non-detectable levels of AWAT2 transcripts or protein

  • Lack of induction during differentiation:

    • AWAT2 is not induced when cells are stimulated to differentiate using established protocols

    • Even treatment with PPARγ agonists like rosiglitazone fails to induce AWAT2 expression

  • Implications for research validity:

    • Current cell culture methods do not adequately induce expression of critical genes required for normal meibum synthesis

    • This questions the relevance of cell culture findings to normal meibomian gland function

    • Without appropriate models that recapitulate meibocyte differentiation, gene expression, and meibum lipid synthesis, it is challenging to confirm the cellular phenotype of immortalized cells

When designing experiments to study AWAT2, researchers should consider:

  • Using tissue samples rather than cultured cells when possible

  • Exploring alternative culture conditions that might better maintain AWAT2 expression

  • Developing 3D culture systems or organoids that better mimic the in vivo environment

  • Employing animal models for functional studies, while recognizing species differences

How should researchers design experiments to study AWAT2's allosteric regulation?

To effectively study allosteric regulation of AWAT2, particularly its enhanced specificity for 11-cis-retinol, researchers should consider the following experimental design strategies:

  • Substrate competition assays:

    • Offer multiple potential substrates simultaneously (e.g., various retinoid isomers, long-chain alcohols)

    • Test how the presence of 11-cis-retinoids affects AWAT2's substrate preference

    • Measure reaction rates with and without allosteric modulators

  • Structural biology approaches:

    • Crystallography studies to determine AWAT2 structure with and without 11-cis-retinoid binding

    • Site-directed mutagenesis to identify key residues involved in allosteric modulation

    • Protein dynamics studies to understand conformational changes upon binding

  • In vitro reconstitution:

    • Purify recombinant AWAT2 for controlled biochemical analysis

    • Systematically vary substrate and modulator concentrations

    • Determine kinetic parameters (Km, Vmax) under different conditions

  • Tissue-specific functional analysis:

    • Compare AWAT2 activity in tissues with and without 11-cis-retinoids

    • Use explant cultures from retina to maintain the native environment

    • Develop systems that better recapitulate the Müller cell microenvironment

What methodological approaches can overcome the challenges of studying AWAT2 in cell culture systems?

Given the documented challenges with AWAT2 expression in standard cell culture systems, researchers may consider these alternative methodological approaches:

  • Modified culture conditions:

    • Test alternative growth factors and hormones that might support AWAT2 expression

    • Explore 3D culture systems that better mimic tissue architecture

    • Co-culture systems with supporting cell types that might provide essential factors

  • Genetic engineering approaches:

    • Develop stable cell lines with inducible AWAT2 expression

    • CRISPR/Cas9-mediated knock-in to introduce fluorescent tags for monitoring

    • Identify and manipulate upstream regulatory factors controlling AWAT2 expression

  • Alternative experimental systems:

    • Ex vivo tissue explants that maintain native cellular context

    • Organoid models that develop more physiologically relevant structures

    • Conditional knockout animal models for in vivo functional studies

  • Tissue-derived primary cells with minimal passaging:

    • Minimize time in culture and number of passages

    • Establish protocols for immediate analysis after tissue isolation

    • Develop cryopreservation methods that better maintain cellular phenotype

How do researchers reconcile the tissue-specific functions of AWAT2 despite its broad expression pattern?

AWAT2 presents an interesting paradox: it has broad tissue expression yet appears to have highly specialized functions in specific tissues. Researchers can address this apparent contradiction through several approaches:

  • Context-dependent regulation:

    • The allosteric regulation demonstrated in retinal Müller cells explains how AWAT2 acquires enhanced specificity for 11-cis-retinol in the visual system

    • Similar tissue-specific modulators might exist in other tissues, directing AWAT2 activity toward different substrates

    • In tissues lacking 11-cis-retinoids (effectively all non-ocular tissues), AWAT2's function would reflect its catalytic activity toward long-chain alcohols or mono- and diacylglycerols

  • Experimental validation across tissues:

    • Comparative substrate utilization studies across different AWAT2-expressing tissues

    • Tissue-specific knockout models to determine functional significance in each location

    • Metabolomic analysis to identify the predominant lipid products in different tissues

  • Expression level considerations:

    • Although AWAT2 is reported in multiple tissues, expression levels vary significantly

    • High expression in sebaceous glands and meibomian glands correlates with major functional roles

    • Lower expression in other tissues might indicate secondary or redundant functions

  • Evolutionary context:

    • Phylogenetic analysis of AWAT2 across species to understand evolutionary specialization

    • Comparison with related acyltransferases to determine unique structural features

This multifaceted approach can help researchers develop a unified model of AWAT2 function that accommodates both its specialized roles in certain tissues and its broader expression pattern.

What are the main contradictions in current AWAT2 research findings and how might they be resolved?

Several contradictions or knowledge gaps exist in current AWAT2 research:

  • Culture model limitations:

    • AWAT2 is highly expressed in meibomian gland tissue but rapidly lost in culture

    • This suggests current culture systems fail to recapitulate critical aspects of the in vivo environment

    • Resolution: Develop improved culture systems that better maintain the physiological context, potentially through 3D culture, co-culture with supporting cells, or identification of critical missing factors

  • Substrate specificity regulation:

    • AWAT2 has broad substrate specificity in vitro but shows preference for specific substrates in different tissues

    • It remains unclear if allosteric modulation by substrates other than 11-cis-retinoids occurs

    • Resolution: Systematic testing of potential allosteric modulators present in different AWAT2-expressing tissues

  • Functional redundancy with other enzymes:

    • AWAT2, DGAT1, and LRAT can all catalyze retinyl ester formation

    • The precise contribution of each enzyme in different tissues remains unclear

    • Resolution: Combinatorial knockout studies and development of specific inhibitors to dissect individual contributions

  • Hydrolase identity in the visual cycle:

    • While AWAT2's role in synthesizing 11-cis-retinyl esters is established, the identity of the hydrolase that cleaves these esters in Müller cells remains unknown

    • Resolution: Proteomic approaches and functional screening to identify this enzyme, followed by studies to determine if AWAT2 and this hydrolase are coordinately regulated

  • Species differences:

    • Differences in AWAT2 function between species (human, rabbit, mouse) have been noted

    • For instance, rabbits synthesize wax esters at a lower relative amount compared to humans

    • Resolution: Systematic comparative studies across species and careful consideration of model system limitations

What technical limitations exist in current methodologies for studying AWAT2 function?

Researchers face several technical challenges when investigating AWAT2:

  • Cell culture limitations:

    • Loss of AWAT2 expression in culture severely limits functional studies

    • Even primary cells rapidly lose expression (−16.9 log2 fold decrease in rabbit cells)

    • Current differentiation protocols fail to induce AWAT2 expression

  • Analytical challenges:

    • Distinguishing AWAT2 activity from other acyltransferases with overlapping substrate specificities

    • Measuring activities with various potential substrates simultaneously

    • Limited availability of specific antibodies and inhibitors

  • In vivo study limitations:

    • Complexity of lipid metabolism pathways and potential compensatory mechanisms

    • Multiple roles of AWAT2 in different tissues complicating phenotype interpretation

    • Ethical considerations and technical difficulties in studying visual function in animal models

  • Substrate availability:

    • Limited commercial availability of specific substrates, particularly 11-cis-retinoids

    • Chemical instability of certain retinoid isomers

    • Challenges in accurately measuring substrate and product concentrations in complex biological samples

  • Integration with systems biology:

    • Difficulty in placing AWAT2 function within broader metabolic networks

    • Limited computational models for lipid metabolism compared to other pathways

    • Challenges in correlating molecular function with physiological outcomes

Addressing these technical limitations requires multidisciplinary approaches combining advanced molecular biology, structural biology, analytical chemistry, and systems biology perspectives.

What are promising strategies for developing improved cell culture models to study AWAT2?

To overcome the limitations of current cell culture models, researchers could pursue several innovative approaches:

  • Identification of critical regulatory factors:

    • Comparative transcriptomic and proteomic analysis between tissue samples and cultured cells to identify missing factors

    • Systematic testing of transcription factors, growth factors, and hormones that might regulate AWAT2 expression

    • Development of defined media formulations specifically optimized for AWAT2 expression

  • Advanced culture systems:

    • Organ-on-chip technologies that better recapitulate tissue architecture and mechanical forces

    • 3D organoid models developed from tissue-specific stem cells

    • Co-culture systems incorporating multiple cell types present in the native tissue environment

  • Genetic engineering approaches:

    • CRISPR/Cas9-mediated knock-in of reporter genes to monitor AWAT2 expression in real-time

    • Creation of conditionally immortalized cell lines that better maintain physiological gene expression

    • Development of systems for inducible expression of AWAT2 and related factors

  • Ex vivo approaches:

    • Tissue explant culture techniques that maintain native cellular contacts

    • Slice cultures for tissues like retina where cellular architecture is particularly important

    • Microdissection approaches to isolate specific cell populations while maintaining their phenotype

  • Single-cell analysis:

    • Single-cell RNA sequencing to identify cell subpopulations that maintain AWAT2 expression

    • Development of protocols to selectively expand these populations

    • Microfluidic approaches for analyzing enzyme activity at the single-cell level

How might gene editing technologies advance our understanding of AWAT2 function?

CRISPR/Cas9 and other gene editing technologies offer powerful approaches to investigate AWAT2:

  • Generation of knockout models:

    • Tissue-specific conditional knockout models to study AWAT2 function in distinct contexts

    • Double or triple knockout models with related enzymes (AWAT1, DGAT1, LRAT) to understand functional redundancy

    • Humanized animal models expressing human AWAT2 to overcome species differences

  • Structure-function analysis:

    • Precise editing of specific amino acid residues to identify catalytic and regulatory sites

    • Creation of domain swap chimeras between AWAT2 and related enzymes

    • Introduction of mutations identified in human populations to assess functional consequences

  • Regulatory element mapping:

    • Editing of putative enhancers and promoter elements to understand transcriptional regulation

    • Development of reporter constructs to monitor AWAT2 expression in response to various stimuli

    • Identification of tissue-specific regulatory elements

  • Knock-in strategies:

    • Introduction of fluorescent or affinity tags for visualization and purification

    • Creation of enzyme variants with altered substrate specificities

    • Development of optogenetic or chemogenetic tools to control AWAT2 activity

  • Therapeutic applications:

    • Correction of mutations that might affect AWAT2 function in diseases like dry eye

    • Development of gene therapy approaches targeting the AWAT2 pathway

    • Creation of cellular models for drug screening

What interdisciplinary approaches might yield new insights into AWAT2 biology?

Progress in understanding AWAT2 biology will likely require integration of multiple disciplines:

  • Structural biology and computational approaches:

    • Determination of AWAT2 crystal structure with various substrates and allosteric modulators

    • Molecular dynamics simulations to understand conformational changes during catalysis

    • Virtual screening for potential inhibitors or activators

  • Systems biology integration:

    • Metabolomic analysis of lipid profiles in different tissues with and without AWAT2

    • Network analysis to position AWAT2 within broader lipid metabolism pathways

    • Multi-omics approaches to understand regulatory mechanisms

  • Clinical research connections:

    • Analysis of AWAT2 expression and function in patient samples from related disorders

    • Correlation of genetic variants with clinical phenotypes in conditions like dry eye disease

    • Development of biomarkers based on AWAT2 activity or product levels

  • Biophysical approaches:

    • Advanced microscopy techniques to visualize AWAT2 localization and dynamics

    • Biochemical assays to measure enzyme kinetics under various conditions

    • Lipidomic analysis to comprehensively profile AWAT2 products in different tissues

  • Comparative biology perspectives:

    • Evolutionary analysis of AWAT2 across species to understand functional conservation

    • Examination of specialized adaptations in species with unique visual systems

    • Exploration of environmental factors influencing AWAT2 expression and function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.