Recombinant Human Adenosine receptor A1 (ADORA1)-VLPs

Shipped with Ice Packs
In Stock

Description

Protein Composition

ADORA1-VLPs incorporate the full-length adenosine A1 receptor (UniProt ID: P30542), a 326-amino-acid protein with seven transmembrane domains . The receptor retains its native post-translational modifications, including glycosylation and palmitoylation at Cys-309, which stabilizes its membrane localization . VLPs are produced in HEK293 cells, ensuring proper folding and functional GPCR activity .

Key Properties of ADORA1-VLPs

PropertyDescription
Expression SystemHEK293 cells
Purity>95% (verified by HPLC)
Biological ActivityBinds adenosine and synthetic ligands (e.g., DPCPX) with nanomolar affinity
ApplicationsDrug screening, structural studies, antibody development

Mechanism of Action

ADORA1 couples with inhibitory G proteins (G<sub>i/o</sub>), reducing intracellular cAMP levels upon adenosine binding . This activity is preserved in VLPs, enabling functional assays such as:

  • Inhibition of forskolin-induced cAMP production .

  • Modulation of calcium signaling via phospholipase C pathways .

Drug Discovery and Screening

ADORA1-VLPs are used to evaluate agonist/antagonist efficacy. For example:

  • N<sup>6</sup>-cyclopentyladenosine (CPA), a selective A1 agonist, demonstrates dose-dependent inhibition of adenylyl cyclase in VLP-based assays .

  • Antagonists like DPCPX block adenosine binding, validated via radioligand displacement assays ([<sup>3</sup>H]DPCPX) .

Antibody Development

Recombinant ADORA1-VLPs serve as immunogens for generating monoclonal antibodies. For instance:

  • Clone 10D12 detects ADORA1 in ELISA, western blot (1:5,000 dilution), and immunohistochemistry (1:200 dilution) .

  • Antibodies target extracellular epitopes, enabling studies of receptor localization and trafficking .

ADORA1-VLPs vs. Cell-Based Assays

FeatureADORA1-VLPsNative Cell Membranes
Purity>95% homogeneity Contaminated with other membrane proteins
ScalabilityHigh-yield production in HEK293 cells Limited by cell culture conditions
Functional StabilityRetains activity after freeze-thaw cycles Prone to receptor desensitization

Challenges and Innovations

  • Desensitization: Chronic agonist exposure reduces ADORA1-VLP responsiveness, mimicking in vivo receptor downregulation .

  • Targeted Delivery: Functionalizing VLPs with tissue-specific ligands (e.g., antibodies) improves therapeutic precision .

Future Directions

  • Gene Therapy: Engineering VLPs to deliver ADORA1-targeted RNA interference for conditions like epilepsy or chronic pain .

  • Biomarker Discovery: Profiling ADORA1-VLP interactions in neurodegenerative diseases .

Product Specs

Buffer
Lyophilized from PBS, 6% Trehalose, pH 7.4
Form
Lyophilized powder
Note: We will default ship the product in lyophilized form with normal blue ice packs. However, if you request to ship in liquid form, it needs to be shipped with dry ice. Please communicate with us in advance and extra fees for dry ice and dry ice box will be charged.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery time.
Note: Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Upon receipt, store the protein at -20°C/-80°C and avoid repeated freeze-thaw cycles to ensure optimal protein activity.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
C-terminal 10xHis-tagged
If you have a specific tag type in mind, please inform us, and we will verify its feasibility for development.
Synonyms
ADORA1; Adenosine receptor A1
Datasheet & Coa
Please contact us to get it.
Expression Region
1-326aa
Research Area
G-protein coupled receptor, Receptor, Transducer
Source
Mammalian cell
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGALVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVTPRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALILFLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFLKIWNDHFRCQPAPPIDEDLPEERPDD
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
Adenosine receptor A1 (ADORA1) is a G protein-coupled receptor that binds adenosine. Its activation leads to the inhibition of adenylyl cyclase via G protein signaling.
Gene References Into Functions
  1. ADORA1 is not a common risk factor or causal gene for Parkinson's disease or dementia with Lewy bodies in the European population. PMID: 27987235
  2. Monocyte-derived macrophages from ankylosing spondylitis patients expressed increased levels of A2AAR and reduced levels of A1 and A2BAR compared to healthy controls. PMID: 29524036
  3. Studies have revealed individual trait characteristics for being either vulnerable or resilient to both alcohol and to sleep deprivation. Both interventions induce gradual increases in cerebral A1AR availability, pointing to a potential common molecular response mechanism. PMID: 30012607
  4. Data suggest that the adenosine A1 receptor might potentiate glycinergic transmission through Galphai/PKA/alpha3 and Gbetagamma/alpha1ins pathways in inflamed rat. PMID: 28882563
  5. Elevated A1 adenosine receptor is associated with sleep deprivation. PMID: 28373571
  6. Mutation in ADORA1 may be associated with early-onset parkinsonism and cognitive dysfunction. PMID: 27134041
  7. Inhibition of cholinergic neurotransmission by beta3-adrenoceptors results from adenosine release via equilibrative nucleoside transporters and prejunctional A1-receptor stimulation in the urinary bladder. PMID: 28446460
  8. This study showed that increased neuronal A1R expression in Rasmussen Encephalitis may be involved in preventing seizures spread and seizures-induced damage, limiting both seizures and inflammation atrophy in one cerebral hemisphere. PMID: 28789481
  9. A1R signaling enhances A2AR-mediated neurodegeneration [review]. PMID: 28441750
  10. Mutational and computational analysis of A1-AR revealed a distinct conformation of the second extracellular loop and a wider extracellular cavity with a secondary binding pocket that can accommodate orthosteric and allosteric ligands. PMID: 28235198
  11. The second extracellular loop is a key allosteric ligand-binding determinant. PMID: 27683013
  12. This study highlights a key role for extracellular loop 2 in A1AR orthosteric ligand binding and receptor activation. PMID: 27683014
  13. Dysregulation in ADORA1/ADORA2A expression was associated with glioma development. PMID: 27038930
  14. A1R mRNA levels and A1R density in PBMCs from idiopathic normal-pressure hydrocephalus patients were significantly lower than control subjects. PMID: 26810542
  15. Its central activation could be an approach to achieving a shifted homeostasis in which physiology is downregulated to a homeostatically-regulated, stable hypometabolic state. (review) PMID: 27333659
  16. In postmortem human prefrontal cortex, the adenosine A1 receptor is coupled preferentially, if not exclusively, to Galphai-3. PMID: 26213104
  17. Results show that ADORA1 rs2228079 and ADORA2A rs5751876 polymorphisms are associated with the risk of Gilles de la Tourette Syndrome, co-morbid disorders, and may affect the age of tics onset in the Polish population. PMID: 26317759
  18. It has the intrinsic ability to form a heteromeric complex with metabotropic glutamate receptor type 1 and mutually modulate signaling. PMID: 26154847
  19. Paeoniflorin promotes the survival of cultured cortical neurons by increasing Akt and ERK1/2 phosphorylation via A1R-mediated transactivation of EGFR. PMID: 25661317
  20. Adenosine A1 receptor activation increases ENT1 activity via protein kinase C. PMID: 25725289
  21. This study revealed variation of regional A1AR availability associated with ADORA1 and particularly ADORA2A SNPs, several of which had previously been shown to be associated with increased anxiety and panic disorder. PMID: 24943643
  22. Stimulation of A1AR and A2BAR had a prominent anti-proliferative/pro-apoptotic effect on the glioblastoma stem cells. PMID: 25429616
  23. Results document that endogenously formed adenosine can chaperone its cognate A1 receptor. PMID: 25354767
  24. Results suggest that the anti-cancer effect of Omega-3 polyunsaturated fatty acids (Omega-3 PUFAs) on gastric cancer is at least partly dependent on activating the ADORA1-mediated apoptosis pathway. PMID: 24896321
  25. Regulation of GABA uptake occurs via modulation of the GABA transporters by the adenosine A1 (A1R) and A2A (A2AR) receptors. PMID: 23657626
  26. Induction of renal proximal tubular IL-11 is a critical intermediary in A1 adenosine receptor-mediated renal protection against acute ischemic kidney injury. PMID: 23813214
  27. Adenosine regulates bone metabolism via A1, A2A, and A2B receptors. PMID: 23682121
  28. Imiquimod suppresses propagation of herpes simplex virus 1 by upregulation of cystatin A via the adenosine receptor A1 pathway. PMID: 22787201
  29. A1/A2 adenosine receptor activation does not directly contribute to cutaneous active vasodilatation. PMID: 22356216
  30. A(1) and A(2B)ARs could be potential biomarkers able to provide an early indication of SA risk, and their stimulation may turn out to improve fetoplacental perfusion by increasing vascular endothelial growth factor (VEGF) and nitric oxide (NO). PMID: 22867902
  31. In patients with stable angina, ADORA1 agonist capadenoson lowers exercise heart at comparable maximum workload, which is associated with improved total exercise time and prolongation of time to ischemia. PMID: 22370739
  32. Results indicate a role for adenosine receptor A1 and A2A gene polymorphisms in susceptibility to apnea of prematurity and bronchopulmonary dysplasia and in interindividual variability to caffeine response. PMID: 22462821
  33. Data suggest that expression of ADORA1 is too low to play a major role in regulating lipogenic gene expression in hepatocytes; studies include investigation of gene expression under the influence of ADORA1 agonists. PMID: 22449383
  34. Data show that expression of A1Rs induced adipocyte differentiation, whereas A2bR expression inhibited adipogenesis and stimulated an osteoblastic phenotype. PMID: 21730968
  35. AMP and a non-hydrolyzable AMP analog (deoxyadenosine 5'-monophosphonate, ACP) directly activated the adenosine A(1) receptor. PMID: 22215671
  36. Inhibition of human mast cell activation would be a mechanism for A1 AR antagonists, but not A(2B) AR antagonists. PMID: 21506953
  37. Adenosine receptor expression and activation during the differentiation of mesenchymal stem cells to osteoblasts and adipocytes were investigated. PMID: 21590734
  38. Two genes involved in cardiovascular diseases, ADORA1 and PTGDS, were differentially up-regulated in epicardial adipose tissue compared to mediastinal and subcutaneous adipose tissue. PMID: 21603615
  39. Data suggest that adenosine deficiency may be relevant to human epilepsy and that a ketogenic diet can reduce seizures by increasing adenosine A1 receptor-mediated inhibition. PMID: 21701065
  40. ADORA1 was expressed in the nucleus, perinucleus, and cytoplasm of retinal pigment epithelium. PMID: 21542986
  41. Report implicating genetic variability in the A1AR with post-traumatic seizures. PMID: 20609566
  42. LUF5834 represents a novel high affinity radioligand for the A(1)R and may prove a useful tool to provide estimates of inverse agonist efficacy at this receptor. PMID: 20599769
  43. Results suggest that adenosine-mediated signaling in the heart requires a balance between A(1)- and A(2A)-receptors. PMID: 20354569
  44. Report fluorescence-based techniques, and in particular the development of fluorescent ligands, to study the pharmacology of the adenosine A1 receptor. PMID: 20105183
  45. Findings suggest that the adenosine A1 (and possibly coordinated with A2a) receptors contribute to dendritic cell differentiation and survival. PMID: 20085598
  46. Studies indicate that adenosine mediates its actions by means of activation of specific G protein-coupled receptors, for which four subtypes: A1R, A2AR, A2BR, and A3R have been identified so far. PMID: 19883624
  47. Adenosine, thus, suppresses CW2 human colonic cancer growth by inducing apoptosis as mediated via A(1) adenosine receptors. PMID: 19822392
  48. Data suggest that adenosine receptor modulation may be useful for refining the use of chemotherapeutic drugs to treat human cancer more effectively. PMID: 19794965
  49. ADORA1 polymorphisms may represent good candidate markers for schizophrenia research, and ADORA1 may be involved in the pathophysiological mechanisms of schizophrenia in Japanese populations. PMID: 19820430
  50. Human A1 adenosine receptor overexpressed in adipose tissue of transgenic mice protects them from obesity-related insulin resistance. PMID: 11703426

Show More

Hide All

Database Links

HGNC: 262

OMIM: 102775

KEGG: hsa:134

STRING: 9606.ENSP00000308549

UniGene: Hs.77867

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the primary signaling pathways mediated by ADORA1?

ADORA1 primarily signals through the following pathways:

  • Inhibition of adenylate cyclase: Activation causes binding of Gi1/2/3 or Go proteins, resulting in decreased cAMP production and reduced protein kinase A (PKA) activity .

  • Activation of phospholipase C (PLC): This leads to increased inositol triphosphate/diglyceride concentrations .

  • Modulation of ion channels: Several types of potassium channels are activated, while N-, P-, and Q-type calcium channels are inhibited .

  • β-arrestin recruitment: Upon stimulation, ADORA1 can recruit β-arrestins, leading to either receptor desensitization or downstream signaling independent of G proteins .

  • MAPK/PI3K pathways: ADORA1 activation can stimulate these pathways, contributing to various cellular responses .

The specific pathway engaged can be influenced by agonist type, receptor concentration, and cellular context .

Where is ADORA1 primarily expressed and what physiological functions does it regulate?

ADORA1 displays high expression levels in:

  • CNS: Cortex, cerebellum, hippocampus, and dorsal horn of the spinal cord

  • Cardiovascular system: Atria and vascular smooth muscle

  • Other tissues: Eye, adipose tissue

Table: Key Physiological Functions of ADORA1

SystemFunctionMechanism
NervousSleep promotionInhibiting arousal of cholinergic neurons in basal forebrain
NervousNeuroprotectionReducing excitotoxicity and inflammatory responses
CardiovascularRegulation of heart rateInhibition of calcium channels, activation of potassium channels
CardiovascularMyocardial protectionRegulating oxygen consumption and coronary blood flow
MetabolicAntilipolytic effectInhibition of adenylate cyclase in adipocytes
ThermoregulatoryHypothermiaVia brain neuronal ADORA1 and ADORA1 on neurons outside the blood-brain barrier
InflammatoryModulation of immune responsesBoth pro- and anti-inflammatory effects depending on context

ADORA1 plays crucial roles in sleep regulation, cardiovascular function, temperature regulation, and inflammatory responses .

How should ADORA1-VLPs be handled and prepared for optimal experimental use?

For optimal experimental use of ADORA1-VLPs:

Storage and Handling:

  • Store lyophilized powder at -20°C/-80°C upon receipt

  • Aliquot after reconstitution to avoid repeated freeze-thaw cycles

  • Reconstitute in PBS or buffer of choice, maintaining pH around 7.4

Preparation for Experiments:

  • Thaw aliquots at room temperature or on ice depending on experimental needs

  • For membrane binding assays, incorporate into appropriate lipid bilayers

  • For cellular studies, optimize transfection or treatment protocols based on cell type

Quality Control Considerations:

  • Verify receptor functionality through binding assays before complex experiments

  • Monitor protein stability with Western blotting if stored for extended periods

  • Consider using fresh preparations for critical experiments requiring optimal receptor activity

While the shelf life of liquid preparations is typically 6 months at -20°C/-80°C, lyophilized forms maintain stability for approximately 12 months under proper storage conditions .

What are the most effective methods for studying ADORA1 ligand binding and activation in experimental systems?

Several methodologies have proven effective for studying ADORA1 binding and activation:

1. Radioligand Binding Assays:

  • Gold standard for determining binding affinity (Ki) and kinetics

  • Commonly used radioligands include [³H]DPCPX (antagonist) and [³H]CPA (agonist)

  • Competition binding assays can determine affinity of unlabeled compounds

  • Saturation binding experiments determine receptor density (Bmax)

2. Functional Assays:

  • cAMP Inhibition Assays: Measure ADORA1-mediated inhibition of forskolin-stimulated cAMP production using GloSensor™ or ELISA methods

  • β-arrestin Recruitment: NanoBit® reporter assay allows real-time monitoring of β-arrestin 2 recruitment following receptor activation

  • Calcium Flux Assays: Measure PLC activation downstream of ADORA1 stimulation

3. Advanced Labeling Techniques:

  • Covalent probes like LUF7909 can be used for SDS-PAGE, confocal microscopy, and chemical proteomics experiments

  • Click chemistry approaches allow visualization of labeled receptors in complex biological samples

4. In Vivo Imaging:

  • PET imaging with [¹⁸F]CPFPX enables visualization of ADORA1 distribution in living systems

Advanced experiments may combine these approaches to gain comprehensive insights into receptor pharmacology and function.

What experimental design considerations are important when using ADORA1-VLPs in true experimental research?

When designing true experimental research with ADORA1-VLPs, consider:

1. Experimental Design Structure:

  • Implement proper controls (positive, negative, vehicle)

  • Consider randomization and blinding procedures for unbiased analysis

  • Use appropriate sample sizes based on power analysis

  • Include validation steps to confirm specificity of observed effects3

2. Receptor-Specific Considerations:

  • Account for ADORA1's sensitivity to physiological adenosine levels by controlling experimental conditions

  • Consider GTP-dependent shifts in agonist binding (high and low-affinity states)

  • Factor in potential heterodimer formation with other receptors

  • Be aware of species differences in receptor pharmacology and signaling

3. True Experimental Design Options:

  • Post-test only control group design: Test control and experimental groups after intervention

  • Pre-test/post-test control group design: Test before and after intervention

  • Solomon four-group design: Combines previous designs to counter threats to internal validity3

4. Data Analysis Approaches:

  • Use appropriate statistical tests based on experimental design and data distribution

  • Consider potential confounding variables such as receptor desensitization

  • Validate findings across multiple experimental paradigms or cell models

Proper experimental design ensures reliable, reproducible results when working with complex membrane proteins like ADORA13 .

How can ADORA1 polymorphisms impact receptor function and disease susceptibility?

ADORA1 polymorphisms can significantly influence receptor function and disease association through several mechanisms:

Impact on Receptor Function:

Single nucleotide polymorphisms (SNPs) in the ADORA1 gene can alter:

  • Receptor expression levels

  • Ligand binding affinity

  • G-protein coupling efficiency

  • Receptor desensitization and internalization

  • β-arrestin recruitment patterns

Disease Associations:

Research has linked ADORA1 polymorphisms to numerous conditions:

  • Cardiovascular disorders: Altered infarct size in ischemic cardiomyopathy

  • Neurological conditions: Post-traumatic seizures, migraine with aura

  • Psychiatric disorders: Schizophrenia, blood-injury phobia, panic disorder, autism spectrum disorder

  • Metabolic conditions: Altered adipocyte function and lipolysis

Receptor Availability:

A key study using [¹⁸F]CPFPX PET imaging found that certain ADORA1 and ADORA2A SNPs significantly affected ADORA1 availability in the brain. Notably, the rs5751876 T-allele (previously identified as a risk factor for increased anxiety) corresponded to consistently higher ADORA1 availability across brain regions, particularly in areas associated with the fear network .

These findings suggest that genetic variation may predispose individuals to certain conditions by altering receptor expression patterns, highlighting the importance of considering genetic factors when designing ADORA1-targeted therapeutics .

What are the current challenges in developing selective ADORA1 probes for research applications?

Developing selective ADORA1 probes faces several significant challenges:

1. Selectivity Issues:

  • High structural homology between adenosine receptor subtypes (A1, A2A, A2B, A3)

  • Common binding pocket characteristics that accommodate similar ligands

  • Cross-reactivity with other purinergic receptors and binding sites

2. Technical Challenges:

  • Poor solubility of many ADORA1 ligands in physiological buffers

  • Low expression levels of native receptors in many cell types

  • Receptor post-translational modifications (particularly glycosylation) affecting probe binding

3. Detection Limitations:

  • Initial attempts using trypsin as a digestion enzyme for mass spectrometry failed to detect ADORA1-specific peptides, requiring alternative approaches like chymotrypsin digestion

  • High background signals in tissue with endogenous expression

  • Variability in glycosylation patterns between tissues affecting apparent molecular weight and detection

4. Current Progress:
Recent development of the affinity-based probe LUF7909 demonstrates progress in overcoming these challenges. This probe:

  • Shows selectivity for ADORA1 over other adenosine receptors

  • Enables detection through click chemistry with fluorophores or biotin

  • Allows visualization in gel-based experiments, confocal microscopy, and chemical proteomics

  • Achieves >200-fold enrichment of ADORA1 in pull-down experiments

Future probe development should focus on further improving selectivity, cell permeability, and detection sensitivity while minimizing off-target effects .

How does ADORA1 interact with other cellular components in physiological and pathological conditions?

ADORA1 engages in complex interactions with diverse cellular components:

1. Receptor-Receptor Interactions:

  • Forms homo-oligomers and heterodimers with other GPCRs (particularly A2A)

  • Receptor dimerization can alter pharmacological properties and signaling profiles

  • Different oligomeric states may predominate in specific tissues or disease states

2. G Protein Interaction Specificity:

  • Primary coupling to Gi/o proteins (Gi-1, Gi-2, Gi-3, Go)

  • Does not couple efficiently to Gs or Gz proteins

  • Coupling preferences can be modulated by receptor density and cellular context

3. β-arrestin Recruitment Dynamics:

  • ADORA1 recruitment of β-arrestin is regulated partially through receptor phosphorylation by G protein-coupled receptor kinases (GRKs), particularly GRK2

  • Inhibition of GRK2-mediated phosphorylation results in decreased β-arrestin 2 recruitment

  • The role of other GRKs in receptor regulation remains controversial

4. Pathological Context-Dependent Interactions:

ConditionADORA1 InteractionConsequence
InflammationAltered neutrophil interactionsChemotaxis and adherence at low adenosine concentrations
IschemiaEnhanced interaction with protective pathwaysReduced necrotic and apoptotic cell death
HypoxiaDecreased receptor densityReceptor desensitization within 90 minutes
CancerEnhanced expression in certain tumor typesAltered tumor microenvironment
Psychostimulant addictionInteraction with dopaminergic systemsModulation of psychostimulant effects

Understanding these interactions provides insight into both physiological functions and potential therapeutic approaches for conditions like inflammation, ischemia, and addiction .

What are common technical challenges when working with ADORA1-VLPs and how can they be addressed?

Researchers frequently encounter several technical challenges when working with ADORA1-VLPs:

1. Protein Stability Issues:

  • Challenge: Rapid degradation or loss of activity during storage or experimental manipulation

  • Solutions:

    • Aliquot immediately after reconstitution to minimize freeze-thaw cycles

    • Store at -80°C rather than -20°C for extended storage

    • Add protease inhibitors during sample preparation

    • Consider adding stabilizing agents like glycerol or specific ligands during storage

2. Glycosylation Heterogeneity:

  • Challenge: Variable receptor molecular weight appearing as smears on SDS-PAGE

  • Solutions:

    • Use PNGase treatment to remove glycans before analysis (strong reduction in molecular weight has been observed)

    • Compare results from different tissue sources, as glycosylation patterns vary (e.g., brain vs. testis ADORA1)

    • Include appropriate molecular weight markers specifically for glycoproteins

3. Detection Sensitivity:

  • Challenge: Low signal-to-noise ratio in binding or functional assays

  • Solutions:

    • For mass spectrometry, use chymotrypsin instead of trypsin for digestion

    • Employ enrichment strategies like pull-down assays prior to detection

    • Consider using covalent probes like LUF7909 for enhanced sensitivity

    • In competitive binding experiments, use ligands with documented high affinity

4. Off-Target Effects:

  • Challenge: Non-specific binding or activation observed at high probe concentrations

  • Solutions:

    • Use competitive controls with selective antagonists like DPCPX

    • Perform experiments in both receptor-expressing and control cells

    • Use the lowest effective concentration of probe (e.g., close to Kd values)

    • Consider cell-based rather than membrane-based assays for improved specificity

By anticipating these challenges and implementing appropriate solutions, researchers can improve the reliability and reproducibility of ADORA1-VLP experiments.

How can researchers accurately interpret conflicting data regarding ADORA1 signaling pathways?

When faced with conflicting data about ADORA1 signaling, researchers should consider several factors:

1. Experimental Context Variations:

  • Cell Type Dependency: ADORA1 signaling can vary significantly between cell types due to different expression levels of signaling components. For example, coupling efficiency to different G-protein subtypes may vary between neuronal and cardiac cells .

  • Species Differences: Human and rodent ADORA1 may exhibit subtle differences in signaling preferences or ligand affinities, requiring careful consideration when translating findings across species.

  • Receptor Reserve Effects: High receptor expression can mask partial agonism, making weak partial agonists appear as full agonists in overexpression systems.

2. Methodological Considerations:

  • Assay Timing: β-arrestin recruitment to ADORA1 shows kinetic differences compared to G-protein signaling. The IC50 value of 126 µM published for βARK-1 inhibitor aligns with observations that efficient inhibition of β-arrestin 2 recruitment starts at 50 µM and higher .

  • Agonist Selection: Different agonists can bias signaling toward specific pathways. In β-arrestin recruitment assays, adenosine, NECA, and CPA showed significant increases in β-arrestin 2 recruitment, while CGS 21680, BAY 60-6583, and 2-Cl-IB-MECA did not significantly alter recruitment .

  • Probe Specificity: At 1 μM concentration, the probe LUF7909 shows additional labeling beyond ADORA1, suggesting potential off-target effects that could confound interpretations .

3. Reconciliation Strategies:

  • Perform parallel experiments using multiple complementary techniques

  • Validate findings across different cell models with varying receptor expression levels

  • Use pharmacological tools with well-documented selectivity profiles

  • Consider biased signaling as a potential explanation for discrepant findings

  • Employ gene editing approaches (CRISPR-Cas9) to confirm receptor specificity of observed effects

4. Emerging Concepts:
Recent research suggests ADORA1 signaling complexity might be explained by:

  • Receptor oligomerization affecting signaling preferences

  • Compartmentalized signaling in specific cellular microdomains

  • Temporal separation of signaling events

  • Cell-specific expression of regulatory proteins

Understanding these factors can help researchers properly contextualize apparently conflicting results.

What quality control measures should be implemented when validating new ADORA1-targeted compounds or tools?

Rigorous quality control is essential when validating new ADORA1-targeted compounds or research tools:

1. Chemical and Structural Validation:

  • Confirm compound identity and purity using analytical techniques (HPLC, NMR, mass spectrometry)

  • Assess compound stability under experimental conditions (temperature, pH, time)

  • For complex tools like VLPs, verify protein integrity through SDS-PAGE and Western blotting

  • For tagged constructs, confirm tag accessibility using appropriate detection methods

2. Pharmacological Characterization:

  • Determine binding affinity through direct binding assays with appropriate controls

  • Examples from literature show specific displacing concentrations:

    • DPCPX showed an IC50 of 105 nM in β-arrestin recruitment assays

    • The covalent antagonist LUF7909 showed clear labeling at approximately its apparent Ki (16 nM)

  • Assess selectivity across all adenosine receptor subtypes (A1, A2A, A2B, A3)

  • At 1 μM concentration, LUF7909 showed minimal cross-reactivity with other adenosine receptors

3. Functional Validation:

  • Confirm expected signaling outcomes through multiple functional assays:

    • cAMP inhibition assays (primary ADORA1 signaling pathway)

    • β-arrestin recruitment

    • Calcium mobilization (if applicable)

    • Downstream effector phosphorylation

  • Validate specificity using receptor knockout/knockdown systems or competitive controls

4. Advanced Validation Approaches:

  • Employ molecular docking to predict binding modes (as performed with LUF7909 using the crystal structure of adenosine-bound ADORA1, PDB: 6D9H)

  • Use BRET/FRET techniques to assess real-time molecular interactions

  • Consider biased signaling profiles by comparing multiple functional endpoints

  • For labeled compounds, verify cellular localization using confocal microscopy

  • Perform structure-activity relationship studies with close analogs

5. Reproducibility Assessment:

  • Test compounds across multiple batches and lots

  • Validate results across different experimental systems

  • Include appropriate positive and negative controls

  • Document detailed protocols to enable reproduction by other laboratories

Implementing these quality control measures ensures that new ADORA1-targeted tools provide reliable and reproducible results in research applications .

How can ADORA1-VLPs be utilized to study receptor-mediated effects in disease models?

ADORA1-VLPs offer versatile applications for studying receptor-mediated effects in disease models:

1. Neurological Disorders:

  • In models of ischemia, ADORA1-VLPs can help elucidate the protective mechanisms against hypoxia-induced ventricular dilatation and white matter loss

  • For sleep disorders, they can facilitate investigation of ADORA1's role in promoting sleep by inhibiting arousal of cholinergic neurons in the basal forebrain

  • In seizure models, ADORA1-VLPs can help study the anticonvulsant properties of receptor activation

2. Cardiovascular Diseases:

  • ADORA1-VLPs enable examination of receptor regulation of myocardial oxygen consumption and coronary blood flow

  • In ischemia-reperfusion injury models, they can help investigate the cardioprotective effects of ADORA1 activation

  • For hypertension studies, they facilitate research on ADORA1's role in vascular smooth muscle regulation

3. Inflammation and Immune Regulation:

  • ADORA1-VLPs can be used to study dual pro-inflammatory and anti-inflammatory roles:

    • Pro-inflammatory: Neutrophil chemotaxis, neutrophil adherence to endothelium, upregulation of endothelial P-selectin expression

    • Anti-inflammatory: Protection in models of kidney, heart, liver, renal, lung, and brain injury

    • Sepsis models: Attenuating hyperacute inflammatory responses

4. Methodological Approaches:

  • Use true experimental research designs when applying ADORA1-VLPs:

    • Post-test only control group design

    • Pre-test/post-test control group design

    • Solomon four-group design for countering threats to internal validity3

  • Incorporate appropriate controls including receptor knockdowns/knockouts

  • Consider tissue-specific expression patterns and relevant concentrations of endogenous adenosine

When designing studies, researchers should account for the known biophysical properties of ADORA1, including its glycosylation pattern and binding characteristics, which may vary across tissue and disease contexts .

What insights have ADORA1 genetic studies provided for personalized medicine approaches?

Genetic studies of ADORA1 have yielded significant insights for personalized medicine:

1. Genetic Variants Associated with Disease Risk:
Multiple single nucleotide polymorphisms (SNPs) in the ADORA1 gene have been linked to various conditions:

  • Cardiovascular disorders: Variants affecting infarct size in ischemic cardiomyopathy

  • Neurological conditions: Polymorphisms associated with post-traumatic seizures and migraine with aura

  • Psychiatric disorders: SNPs linked to schizophrenia, blood-injury phobia, and panic disorder

  • Developmental conditions: Variants associated with autism spectrum disorder

2. Treatment Response Prediction:
ADORA1 polymorphisms may predict:

  • Caffeine sensitivity and response

  • Vulnerability to caffeine-induced anxiety

  • Efficacy of adenosine-targeting therapeutics

  • Individual responses to sleep modulation

3. Receptor Availability and Distribution:
A key study using [¹⁸F]CPFPX PET imaging revealed:

  • SNPs in both ADORA1 and ADORA2A genes associated with variations in ADORA1 binding

  • Strongest effects were found in non-smoking subjects for ADORA2A SNPs rs2236624 and rs5751876

  • The rs5751876 T-allele, previously identified as a risk factor for increased anxiety, corresponded to consistently higher ADORA1 availability across all brain regions

4. Clinical Implications:
These findings suggest potential for:

  • Genetic screening to identify individuals who might benefit from ADORA1-targeted therapies

  • Dose adjustments based on genetic profiles to optimize therapeutic effects

  • Development of targeted treatments for specific genetic subgroups

  • Personalized approaches to conditions where ADORA1 plays a key role, such as sleep disorders, anxiety, and cardiovascular protection

The association of specific SNPs with receptor availability in regions of the fear network particularly warrants further investigation for personalized approaches to anxiety disorders .

How can receptor desensitization patterns inform the development of novel ADORA1-targeted therapeutic strategies?

Understanding ADORA1 desensitization provides critical insights for therapeutic development:

1. Mechanisms of ADORA1 Desensitization:

  • Temporal Profile: Desensitization can occur rapidly (within 90 minutes) under hypoxic conditions

  • Molecular Basis: Involves receptor phosphorylation, β-arrestin recruitment, and internalization

  • Regulatory Proteins: GRK2 plays a key role, with inhibition of GRK2-mediated phosphorylation resulting in decreased β-arrestin 2 recruitment

  • Chronic Effects: Long-term agonist exposure can lead to decreased receptor density and impaired G-protein coupling

2. Tissue-Specific Desensitization Patterns:

  • Adipocytes: Chronic ADORA1 agonist administration causes decreased receptor levels and reduced inhibition of isoproterenol-stimulated adenylyl cyclase

  • Neuronal Cells: In cerebellar granule cells, chronic agonist exposure results in time- and concentration-dependent reduction in receptor density and G-protein coupling

  • Cardiovascular System: Desensitization may be a protective mechanism against excessive cardiovascular effects

3. Therapeutic Implications:

  • Biased Ligands: Developing compounds that preferentially activate specific signaling pathways while minimizing β-arrestin recruitment

  • Partial Agonists: May induce less desensitization than full agonists while maintaining therapeutic efficacy

  • Pulsatile Administration: Intermittent dosing strategies might reduce desensitization compared to continuous administration

  • Allosteric Modulators: Compounds like VCP 171 can enhance agonist effects by approximately 25% without directly activating the receptor, potentially resulting in different desensitization profiles

4. Research Findings Informing Drug Development:

  • Studies show that ligand receptor binding kinetics (residence time) rather than affinity or potency play an essential role in regulating cellular responses

  • Long residence time ADORA1 agonists produce sustained wash-resistant effects that persist despite removal of excess agonist

  • This effect is less pronounced or lost for agonists with medium or short receptor residence time

These insights suggest that optimizing binding kinetics and signaling bias, rather than merely enhancing binding affinity, may be crucial for developing effective ADORA1-targeted therapeutics with improved desensitization profiles .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.