Recombinant Human Adenosine receptor A1 (ADORA1)

Shipped with Ice Packs
In Stock

Description

Protein Structure and Composition

Recombinant Human Adenosine A1 Receptor is a full-length human protein consisting of 326 amino acids that forms a complex three-dimensional structure essential for its function as a transmembrane receptor . The complete amino acid sequence has been thoroughly characterized and includes distinctive domains responsible for ligand binding, G-protein interaction, and signal transduction across the cell membrane . This sequence, which begins with MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVK and continues through the entire 326-amino acid chain, determines the receptor's ability to recognize adenosine and initiate downstream signaling cascades . The structural integrity of the receptor is maintained by specific amino acid arrangements that form the characteristic seven transmembrane domains typical of G-protein coupled receptors, allowing it to span the cell membrane and transduce extracellular signals to intracellular responses.

Expression Systems and Production Methods

The production of recombinant ADORA1 typically utilizes cell-free expression systems, which offer significant advantages for obtaining pure and functional receptor protein . This approach allows researchers to generate the receptor with at least 85% purity, making it suitable for various analytical techniques including SDS-PAGE and functional assays . Cell-free systems provide a controlled environment for protein synthesis without the complications of cellular metabolism, resulting in high-quality recombinant protein that maintains its native conformational properties. The purification process typically involves multiple chromatographic steps to isolate the receptor from other components of the expression system, ensuring that the final product accurately represents the structure and function of naturally occurring ADORA1 in human tissues.

G Protein Coupling and Signal Transduction

The primary function of ADORA1 is to serve as a receptor for adenosine, a ubiquitous neuromodulator that plays crucial roles in maintaining oxygen and energy supply throughout the body . Upon activation by adenosine, ADORA1 mediates its effects primarily through coupling with Gi/o proteins, which leads to inhibition of adenylyl cyclase activity . This inhibitory action results in decreased production of cyclic AMP (cAMP) from ATP, causing subsequent reduction in protein kinase A (PKA) activity and decreased phosphorylation of the cAMP response element binding protein (CREB) . The signaling cascade initiated by ADORA1 activation influences numerous cellular processes, including neurotransmission, metabolism, and immune function, demonstrating the receptor's broad physiological significance. The specificity of ADORA1 for Gi/o proteins distinguishes it from other adenosine receptor subtypes and determines its characteristic inhibitory effects on cellular activity.

Alternative Signaling Pathways

While the primary signaling mechanism of ADORA1 involves inhibition of adenylyl cyclase, the receptor also participates in several alternative signaling pathways that contribute to its diverse physiological effects . In certain cellular contexts, ADORA1 can increase phospholipase C (PLC) activity through a pertussis toxin-sensitive G protein, leading to the generation of second messengers such as inositol trisphosphate and diacylglycerol . The receptor can also directly couple to and regulate ion channels, including cardiac potassium channels and various subtypes of voltage-sensitive calcium channels (types Q, N, and P) . These additional signaling capabilities expand the functional repertoire of ADORA1 beyond simple inhibition of cAMP production, enabling it to modulate multiple aspects of cellular physiology simultaneously. The ability to engage different signaling pathways depending on the cellular context may explain the tissue-specific effects of ADORA1 activation observed throughout the body.

Tissue-Specific Actions and Physiological Effects

ADORA1 exhibits remarkable diversity in its physiological effects across different tissues and organ systems, reflecting its involvement in multiple regulatory pathways. The following table summarizes the key actions of ADORA1 in various tissues:

SystemActionTissue/CellSubtypeReference
Adenylate cyclaseInhibitionAdipocytesA1
Adenylate cyclaseInhibitionHeartA1
Adenylate cyclaseInhibitionSmooth muscleA1
Guanylate cyclaseActivationSmooth muscleA1
Low K cAMP phosphodiesteraseModulationAdipocytesA1
Low K cAMP phosphodiesteraseModulationBrainA1
Potassium effluxActivationHeartA1
Potassium effluxActivationHippocampusA1

Binding Properties and Pharmacological Profile

The pharmacological characteristics of ADORA1 have been extensively studied using recombinant forms of the receptor in various binding and functional assays . Antagonists such as [3H]MRS1754 bind to recombinant human adenosine A1 receptor with a pKi value of 6.39, corresponding to a Ki of approximately 403 nM, as demonstrated in multiple independent studies . Binding assays using radioligands such as [125I]IABA have provided valuable insights into the receptor's interaction with various ligands, including both agonists and antagonists . The consistent binding parameters observed across different experimental approaches confirm the reliability of recombinant ADORA1 as a model for studying receptor-ligand interactions. The detailed characterization of ADORA1 binding properties has facilitated the development of selective ligands that target this receptor subtype, providing valuable tools for research and potential therapeutic applications.

Single Nucleotide Polymorphisms in ADORA1 Gene

Genetic variations within the ADORA1 gene have significant implications for receptor function and their association with various physiological and pathological conditions . Single nucleotide polymorphisms (SNPs) in both ADORA1 and the related ADORA2A genes have been identified and studied for their effects on receptor availability and signaling capacity . These genetic variants may alter the expression level, binding affinity, or signaling efficiency of the receptor, potentially contributing to individual differences in response to adenosine and drugs targeting adenosine receptors. The functional consequences of these genetic variations extend beyond simple alterations in receptor properties to include broader physiological effects, such as changes in anxiety susceptibility, pain perception, and response to caffeine. Understanding the relationship between ADORA1 genetic variants and receptor function provides valuable insights into the molecular basis of individual differences in adenosine-mediated processes.

Receptor Availability in the Brain and Anxiety

A significant association has been established between certain ADORA1 and ADORA2A gene variants and the availability of A1 receptors in specific brain regions, with potential implications for anxiety and other neuropsychiatric conditions . Using positron emission tomography (PET) with the A1AR-selective radioligand [18F]CPFPX, researchers have demonstrated that SNPs in both genes influence the binding potential of A1 receptors in the brains of healthy humans . Particularly strong effects were observed in non-smoking subjects for ADORA2A SNPs rs2236624 and rs5751876, with the latter previously identified as a risk factor for increased anxiety . Interestingly, carriers of the rs5751876 T-allele showed consistently higher A1AR availability in all brain regions, suggesting a potential mechanism by which this genetic variant might contribute to anxiety susceptibility . These findings indicate that genetic variations can modulate not only the direct target receptor (A2A in this case) but also functionally related receptors (A1), highlighting the complex interplay between genetic factors and receptor systems in the brain.

Receptor Desensitization and Regulation

The function of ADORA1 is subject to dynamic regulation through various mechanisms, including desensitization following prolonged exposure to agonists . In rat adipocytes, chronic administration of the A1AR agonist R-phenylisopropyladenosine (R-PIA) leads to a decrease in A1AR levels and reduced inhibition of isoproterenol-stimulated adenylyl cyclase activity . These changes are accompanied by decreased levels of pertussis-sensitive G proteins and increased levels of Gs proteins in the plasma membrane, suggesting a comprehensive adaptation of the signaling machinery . Similar desensitization processes have been observed in other tissues, including cerebellar granule cells, where chronic treatment with A1AR agonist results in time- and concentration-dependent reduction in receptor density and G-protein coupling . Environmental factors such as hypoxia can also influence ADORA1 regulation, as demonstrated by decreased A1AR density in rat hippocampal slices under hypoxic conditions, an effect that could be mimicked by adenosine receptor agonists and prevented by antagonists . These regulatory mechanisms ensure appropriate receptor responsiveness under various physiological and pathological conditions.

Neurological and Psychiatric Implications

ADORA1 plays crucial roles in various neurological functions and has been implicated in several neurological and psychiatric disorders . The receptor's widespread distribution in the brain, particularly in regions associated with cognition, emotion, and motor control, underlies its involvement in processes such as sleep regulation, neuroprotection, and modulation of neurotransmitter release. Alterations in ADORA1 expression or function have been linked to conditions including epilepsy, ischemic brain injury, neurodegenerative diseases, and mood disorders. The neuroprotective effects of ADORA1 activation in models of cerebral ischemia and excitotoxicity highlight its potential as a therapeutic target for stroke and related conditions. Furthermore, the association between ADORA1 genetic variants and anxiety susceptibility suggests that the receptor may contribute to the pathophysiology of anxiety disorders and related psychiatric conditions, possibly through interactions with other neurotransmitter systems.

Cardiovascular Function and Pathophysiology

In the cardiovascular system, ADORA1 mediates several protective mechanisms that preserve cardiac function during stress conditions such as ischemia and hypoxia . The receptor's ability to reduce heart rate, decrease contractility, and inhibit excessive catecholamine release contributes to its cardioprotective effects during myocardial ischemia-reperfusion injury. ADORA1 activation also promotes preconditioning, a phenomenon in which brief periods of ischemia protect the heart against subsequent, more severe ischemic insults. The role of ADORA1 in regulating vascular tone varies depending on the specific vascular bed, with predominant vasodilatory effects in certain vessels and vasoconstrictive effects in others. These diverse cardiovascular actions make ADORA1 a potential target for therapeutic interventions in conditions such as heart failure, arrhythmias, and ischemic heart disease, where modulation of cardiac function and blood flow distribution could provide significant clinical benefits.

Metabolic Regulation and Energy Homeostasis

ADORA1 contributes to metabolic regulation through its effects on various tissues involved in energy homeostasis, including adipose tissue, liver, and skeletal muscle . In adipocytes, ADORA1 activation inhibits lipolysis by reducing cAMP production, thereby decreasing the activity of hormone-sensitive lipase and limiting the release of free fatty acids into the circulation. The receptor also influences insulin signaling and glucose metabolism, as evidenced by the finding that desensitization of ADORA1 is associated with desensitization of insulin-dependent glucose transport in cultured adipocytes . These metabolic effects position ADORA1 as a potential target for interventions aimed at conditions such as obesity, diabetes, and metabolic syndrome, where dysregulation of lipid and glucose metabolism contributes to disease pathophysiology. The interaction between ADORA1 and other metabolic regulators, including hormones and neurotransmitters, creates a complex network of signals that collectively maintain energy balance under varying physiological conditions.

Binding Assays and Functional Studies

Recombinant ADORA1 serves as a valuable tool for pharmacological characterization through various binding and functional assays . Radioligand binding studies using compounds such as [3H]MRS1754 and [125I]IABA have established the binding affinities of numerous agonists and antagonists, providing essential information for drug development and structure-activity relationship analyses . Functional assays measuring the inhibition of adenylyl cyclase activity, modulation of ion channel function, or activation of alternative signaling pathways complement binding studies by assessing the efficacy and potency of receptor ligands. These pharmacological approaches have been instrumental in identifying selective ADORA1 modulators and understanding the complex interactions between different adenosine receptor subtypes. The consistent pharmacological properties of recombinant ADORA1 across different experimental systems confirm its validity as a model for studying receptor-ligand interactions and evaluating potential therapeutic compounds.

Imaging Techniques for In Vivo Receptor Visualization

Advanced imaging techniques, particularly positron emission tomography (PET), have enabled non-invasive visualization of ADORA1 distribution and occupancy in living organisms, providing valuable insights into receptor function in health and disease . The development of A1AR-selective radioligands such as [18F]CPFPX has facilitated studies of receptor availability in relation to genetic variants, physiological states, and pathological conditions . PET imaging studies have revealed regional differences in ADORA1 distribution throughout the brain, correlating with the receptor's diverse functions in different neural circuits. This approach has been particularly valuable for investigating the relationship between ADORA1 genetic variants and receptor availability in the human brain, as demonstrated by studies linking specific SNPs to altered binding potential in regions associated with anxiety and fear processing . The combination of genetic analysis, PET imaging, and behavioral assessment provides a powerful framework for understanding how ADORA1 contributes to individual differences in susceptibility to neuropsychiatric conditions and response to adenosine-modulating drugs.

Product Specs

Buffer
For liquid delivery forms, the default storage buffer is a Tris/PBS-based buffer containing 5%-50% glycerol. For lyophilized powder forms, the buffer used prior to lyophilization is a Tris/PBS-based buffer with 6% Trehalose.
Form
Liquid or Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the delivery format, please indicate your preference in the order notes. We will prepare the product according to your request.
Lead Time
3-7 business days
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tagged
Synonyms
ADORA1; Adenosine receptor A1
Datasheet & Coa
Please contact us to get it.
Expression Region
1-326aa
Mol. Weight
39.3 kDa
Protein Length
Full Length
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
G-protein coupled receptor, Receptor, Transducer
Source
in vitro E.coli expression system
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGALVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVTPRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALILFLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFLKIWNDHFRCQPAPPIDEDLPEERPDD
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
Adenosine receptor A1 (ADORA1) is a receptor for adenosine. The activity of this receptor is mediated by G proteins, which inhibit adenylyl cyclase.
Gene References Into Functions
  1. ADORA1 has been determined not to be a common risk factor or causal gene for Parkinson's disease or dementia with Lewy bodies in the European population. PMID: 27987235
  2. Monocyte-derived macrophages from ankylosing spondylitis patients have shown increased levels of A2AAR and reduced levels of A1 and A2BAR compared to healthy controls. PMID: 29524036
  3. Research has identified individual trait characteristics associated with vulnerability or resilience to both alcohol and sleep deprivation. Both interventions lead to gradual increases in cerebral A1AR availability, suggesting a potential common molecular response mechanism. PMID: 30012607
  4. Studies have indicated that the adenosine A1 receptor might potentiate glycinergic transmission through Galphai/PKA/alpha3 and Gbetagamma/alpha1ins pathways in inflamed rat models. PMID: 28882563
  5. Elevated A1 adenosine receptor expression is associated with sleep deprivation. PMID: 28373571
  6. Mutations in ADORA1 may be linked to early-onset parkinsonism and cognitive dysfunction. PMID: 27134041
  7. Inhibition of cholinergic neurotransmission by beta3-adrenoceptors occurs due to adenosine release via equilibrative nucleoside transporters and prejunctional A1-receptor stimulation in the urinary bladder. PMID: 28446460
  8. Research suggests that increased neuronal A1R expression in Rasmussen Encephalitis may be involved in preventing seizure spread and seizures-induced damage, limiting both seizures and inflammatory atrophy in one cerebral hemisphere. PMID: 28789481
  9. A1R signaling is thought to enhance A2AR-mediated neurodegeneration. PMID: 28441750
  10. Mutational and computational analysis of A1-AR revealed a distinct conformation of the second extracellular loop and a wider extracellular cavity with a secondary binding pocket that can accommodate orthosteric and allosteric ligands. PMID: 28235198
  11. The second extracellular loop has been identified as a key allosteric ligand-binding determinant. PMID: 27683013
  12. This study highlights a critical role for extracellular loop 2 in A1AR orthosteric ligand binding and receptor activation. PMID: 27683014
  13. Dysregulation in ADORA1/ADORA2A expression has been linked to glioma development. PMID: 27038930
  14. A1R mRNA levels and A1R density in PBMCs from idiopathic normal-pressure hydrocephalus patients were significantly lower than those observed in control subjects. PMID: 26810542
  15. Central activation of the A1 receptor could potentially be an approach to achieving a shifted homeostasis where physiology is downregulated to a homeostatically-regulated, stable hypometabolic state. (review) PMID: 27333659
  16. In postmortem human prefrontal cortex, the adenosine A1 receptor is preferentially, if not exclusively, coupled to Galphai-3. PMID: 26213104
  17. Results indicate that ADORA1 rs2228079 and ADORA2A rs5751876 polymorphisms are associated with the risk of Gilles de la Tourette Syndrome, co-morbid disorders, and may influence the age of tics onset in the Polish population. PMID: 26317759
  18. The adenosine A1 receptor possesses the intrinsic ability to form a heteromeric complex with metabotropic glutamate receptor type 1, resulting in mutual modulation of signaling. PMID: 26154847
  19. Paeoniflorin promotes the survival of cultured cortical neurons by increasing Akt and ERK1/2 phosphorylation through A1R-mediated transactivation of EGFR. PMID: 25661317
  20. Activation of the adenosine A1 receptor has been shown to increase ENT1 activity via protein kinase C. PMID: 25725289
  21. This study uncovered variations in regional A1AR availability associated with ADORA1 and particularly ADORA2A SNPs, several of which have been previously linked to increased anxiety and panic disorder. PMID: 24943643
  22. Stimulation of A1AR and A2BAR exhibited a prominent anti-proliferative/pro-apoptotic effect on glioblastoma stem cells. PMID: 25429616
  23. Research findings document that endogenously formed adenosine can chaperone its cognate A1 receptor. PMID: 25354767
  24. Results suggest that the anti-cancer effect of Omega-3 polyunsaturated fatty acids (Omega-3 PUFAs) on gastric cancer is at least partially dependent on activating the ADORA1-mediated apoptosis pathway. PMID: 24896321
  25. Regulation of GABA uptake occurs through modulation of GABA transporters by the adenosine A1 (A1R) and A2A (A2AR) receptors. PMID: 23657626
  26. Induction of renal proximal tubular IL-11 has been identified as a critical intermediary in A1 adenosine receptor-mediated renal protection against acute ischemic kidney injury. PMID: 23813214
  27. Adenosine plays a role in regulating bone metabolism through A1, A2A, and A2B receptors. PMID: 23682121
  28. Imiquimod suppresses propagation of herpes simplex virus 1 by upregulating cystatin A via the adenosine receptor A1 pathway. PMID: 22787201
  29. Activation of A1/A2 adenosine receptors does not directly contribute to cutaneous active vasodilatation. PMID: 22356216
  30. A(1) and A(2B)ARs could serve as potential biomarkers, providing an early indication of spontaneous abortion risk. Their stimulation might improve fetoplacental perfusion by increasing vascular endothelial growth factor (VEGF) and nitric oxide (NO). PMID: 22867902
  31. In patients with stable angina, the ADORA1 agonist capadenoson reduces exercise heart rate at comparable maximum workload, associated with improved total exercise time and prolonged time to ischemia. PMID: 22370739
  32. Data suggest a role for adenosine receptor A1 and A2A gene polymorphisms in susceptibility to apnea of prematurity and bronchopulmonary dysplasia, as well as in interindividual variability to caffeine response. PMID: 22462821
  33. Findings indicate that ADORA1 expression is too low to play a major role in regulating lipogenic gene expression in hepatocytes; further studies should investigate gene expression under the influence of ADORA1 agonists. PMID: 22449383
  34. Data show that A1R expression induces adipocyte differentiation, while A2bR expression inhibits adipogenesis and stimulates an osteoblastic phenotype. PMID: 21730968
  35. AMP and a non-hydrolyzable AMP analog (deoxyadenosine 5'-monophosphonate, ACP) directly activated the adenosine A(1) receptor. PMID: 22215671
  36. Inhibition of human mast cell activation would be a mechanism for A AR antagonists, but not A(2B) AR antagonists. PMID: 21506953
  37. The expression and activation of adenosine receptors during the differentiation of mesenchymal stem cells into osteoblasts and adipocytes were investigated. PMID: 21590734
  38. Two genes implicated in cardiovascular diseases, ADORA1 and PTGDS, were differentially up-regulated in epicardial adipose tissue compared to mediastinal and subcutaneous adipose tissue. PMID: 21603615
  39. Data suggest that adenosine deficiency might be relevant to human epilepsy and that a ketogenic diet could potentially reduce seizures by increasing adenosine A1 receptor-mediated inhibition. PMID: 21701065
  40. ADORA1 was expressed in the nucleus, perinucleus, and cytoplasm of retinal pigment epithelium. PMID: 21542986
  41. A report implicating genetic variability in the A1AR with post-traumatic seizures. PMID: 20609566
  42. LUF5834 represents a novel high affinity radioligand for the A(1)R and may prove a useful tool to provide estimates of inverse agonist efficacy at this receptor. PMID: 20599769
  43. Results suggest that adenosine-mediated signaling in the heart requires a balance between A(1)- and A(2A)-receptors. PMID: 20354569
  44. This report explores fluorescence-based techniques, particularly the development of fluorescent ligands, for studying the pharmacology of the adenosine A1 receptor. PMID: 20105183
  45. Findings indicate that the adenosine A1 (and possibly coordinated with A2a) receptors contribute to dendritic cell differentiation and survival. PMID: 20085598
  46. Studies indicate that adenosine mediates its actions by activating specific G protein-coupled receptors, of which four subtypes have been identified so far: A1R, A2AR, A2BR, and A3R. PMID: 19883624
  47. Adenosine, therefore, suppresses CW2 human colonic cancer growth by inducing apoptosis through A(1) adenosine receptors. PMID: 19822392
  48. Data suggest that modulation of adenosine receptors may be beneficial for refining the use of chemotherapeutic drugs to treat human cancer more effectively. PMID: 19794965
  49. ADORA1 polymorphisms may serve as good candidate markers for schizophrenia research. ADORA1 might be involved in the pathophysiological mechanisms of schizophrenia in Japanese populations. PMID: 19820430
  50. Human A1 adenosine receptor overexpression in adipose tissue of transgenic mice protects them from obesity-related insulin resistance. PMID: 11703426

Show More

Hide All

Database Links

HGNC: 262

OMIM: 102775

KEGG: hsa:134

STRING: 9606.ENSP00000308549

UniGene: Hs.77867

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are commonly used for recombinant ADORA1 production?

Multiple expression systems can be used to produce recombinant ADORA1, each with different advantages:

Expression SystemAdvantagesCommon Applications
E. coliCost-effective, high yieldProtein fragments, binding studies
YeastPost-translational modifications, membrane insertionStructural studies
BaculovirusHigher eukaryotic processing, good for GPCRsFunctional assays, structural biology
Mammalian CellNative-like processing, proper foldingSignaling studies, drug screening
Cell-Free ExpressionRapid production, avoids cell toxicityStructural studies, initial screening

Based on available commercial options, researchers frequently use cell-free expression systems for full-length ADORA1, achieving ≥85% purity suitable for SDS-PAGE analysis . Mammalian expression systems are preferred when studying receptor signaling pathways to ensure proper coupling to G proteins .

How can I verify the functionality of recombinant ADORA1?

Functional verification of recombinant ADORA1 typically involves:

  • Ligand binding assays: Using radioliganded binding assays with selective A1 receptor agonists like [³H]2-chloro-N6-cyclopentyladenosine (CCPA) or antagonists like [³H]8-cyclopentyl-1,3-dipropylxanthine (DPCPX) . These assays confirm proper protein folding and ligand binding pocket formation.

  • G protein coupling assays: Measuring inhibition of adenylyl cyclase activity, as ADORA1 activation leads to decreased cAMP levels through Gi/Go protein coupling .

  • Potassium channel modulation: Functional ADORA1 activates several types of potassium channels while inhibiting N-, P-, and Q-type calcium channels .

  • Cellular signaling studies: Measuring downstream effects such as MAPK pathway activation in CHO cells or PKC activation via βγ subunits of Gi/o proteins .

Positive controls using native tissue preparations (e.g., brain membrane fractions) are recommended for comparison, as recombinant and native receptors should display similar pharmacological profiles .

What are the critical domains of ADORA1 involved in ligand binding and selectivity?

Research using chimeric receptors has identified key structural regions of ADORA1 involved in ligand binding:

The most critical determinants for both agonist and antagonist binding and ligand specificity are present in transmembrane domains (TMs) 1-4 . Specifically:

  • Replacing TM1 of A2aAR with the corresponding A1AR region enables some CCPA binding, but with low affinity

  • Adding A1AR TMs 2-4 markedly improves binding affinity

  • TMs 1-4 of A1AR confer wild-type receptor affinity for antagonists like DPCPX

  • When comparing binding properties of constructs containing A1AR TMs 1-4, TMs 1-6, and wild-type A1AR, no significant differences were found across 10 different compounds

Notably, truncated A1AR constructs extending from the amino terminus to just after TM4 showed no binding, indicating that the amino half of the receptor alone is insufficient for ligand binding. This suggests ligand binding requires proper folding and assembly of the complete receptor structure .

The second extracellular loop has also been implicated in ligand binding characteristics, with studies comparing human and mouse ADORA1 finding that four amino acid differences in this region may account for their markedly different ligand binding properties despite 90% sequence identity .

How do different cellular environments affect ADORA1 expression and function?

The cellular environment can significantly impact ADORA1 function and regulation:

What mechanisms regulate ADORA1 desensitization and internalization in recombinant systems?

ADORA1 undergoes complex regulatory processes that can be studied in recombinant systems:

  • Desensitization kinetics: Unlike other adenosine receptors, A1AR is phosphorylated and internalized slowly, with a half-life of several hours, compared to A2A/B receptors (about one hour) and A3 receptors (minutes) .

  • G protein coupling changes: In both recombinant systems and native tissues, chronic A1AR agonist exposure leads to decreased receptor levels and reduced inhibition of adenylyl cyclase, accompanied by decreased levels of pertussis-sensitive G proteins and increased levels of Gs proteins .

  • Phosphorylation mechanisms: Rapid translocation of G protein-coupled receptor kinase (GRK) from cytosol to plasma membrane and subsequent A1AR phosphorylation has been demonstrated within one hour of agonist treatment. Phosphorylated A1AR displays enhanced affinity for arrestin over Gi/Go G-proteins .

  • β-arrestin/ERK1/2 pathway: Long-term (24h) agonist exposure decreases A1AR membrane protein but increases A1AR mRNA 11-fold. This effect depends on β-arrestin1, as its knockdown blocks agonist-mediated down-regulation and suppresses ERK1/2 and AP-1 activities .

  • Recovery mechanisms: After agonist withdrawal, rapid recovery of plasma membrane A1AR occurs, dependent on de novo protein synthesis and ERK1/2 activity but independent of β-arrestin1 and NF-κB .

These findings provide methodological approaches for studying receptor regulation in recombinant systems, which can be verified by comparison with native receptor behavior.

How can I design experiments to study ADORA1-mediated angiogenesis?

ADORA1 activation has been shown to promote angiogenesis through specific mechanisms:

Experimental design should include:

  • Appropriate controls (vehicle, selective antagonists)

  • Concentration-response curves for agonists

  • Verification using both pharmacological tools and genetic approaches

  • Comparison of direct versus indirect effects

  • Analysis of downstream mediators (particularly VEGF)

This approach allows researchers to distinguish between direct effects on endothelial cells and indirect effects mediated through inflammatory cells.

What methods are available for studying ADORA1 expression in specific cell populations?

Several approaches can be used to study cell-specific expression of ADORA1:

  • In situ hybridization (ISH): This technique has been used to profile the expression of Adora1 transcripts in subclasses of neurons (glutamatergic, GABAergic) and glia (astrocytes, oligodendrocytes, microglia) in the auditory forebrain of adult mice. Results indicate that Adora1 is widely expressed but in a manner that varies by cell type and specific location .

  • Single-cell RNA sequencing: This approach can identify cell-specific expression patterns and has important implications for the design of experimental studies targeting Adora1 (e.g., optogenetics, gene editing, pharmacology, behavior) .

  • Immunohistochemistry with validated antibodies: Several commercial antibodies are available for ADORA1 detection in various applications including Western blotting (1:500-1:2000 dilution), immunohistochemistry (1:50-1:200), immunofluorescence (1:50-1:200), immunoprecipitation (1:50), and flow cytometry (1:100) .

  • Receptor autoradiography: Using selective radioligands to map receptor distribution in tissue sections.

Understanding cell-specific expression is crucial because A1R-mediated adenosine signaling differentially impacts subpopulations of neurons and glia in various brain regions .

What are the common challenges in producing functional recombinant ADORA1 and how can they be overcome?

Researchers face several challenges when producing recombinant ADORA1:

  • Protein instability: As a GPCR, ADORA1 contains hydrophobic transmembrane domains that can cause aggregation and misfolding.

    • Solution: Include stabilizing agents like glycerol (50%) in storage buffers and use detergents optimized for membrane proteins .

  • Low expression levels: GPCRs often express poorly in heterologous systems.

    • Solution: Optimize codon usage for the expression host, use strong inducible promoters, and consider fusion partners that enhance expression.

  • Post-translational modifications: Different expression systems produce varying glycosylation patterns.

    • Solution: Select the expression system based on research needs; mammalian cells for native-like modifications, E. coli for studies where glycosylation isn't critical.

  • Verification of functionality: Confirming proper folding and activity.

    • Solution: Use multiple complementary assays including ligand binding, G-protein coupling, and downstream signaling responses .

  • Storage stability: Recombinant GPCRs can lose activity during storage.

    • Solution: Store at -20°C for up to one year, avoid repeated freeze-thaw cycles, and use stabilizing buffer conditions (pH 7.4, 150mM NaCl, 0.02% sodium azide, 50% glycerol) .

How do species differences affect ADORA1 function and experimental design?

Species differences in ADORA1 can significantly impact experimental results:

  • Sequence homology: Human and mouse ADORA1 sequences are 90% identical, yet their ligand binding properties differ markedly when expressed in the same cell line . This is particularly relevant when using animal models to study compounds intended for human applications.

  • Extracellular loops: Four amino acid differences occur in the second extracellular loop between human and mouse receptors, which may account for binding differences .

  • Experimental design considerations:

    • Use species-appropriate ligands and concentration ranges

    • Include proper controls from the species being studied

    • Be cautious when extrapolating results across species

    • Consider creating humanized animal models for translational research

    • When comparing pharmacological profiles, test compounds against receptors from multiple species

  • Verification approaches: When studying novel compounds, test against recombinant receptors from both the experimental animal model and human ADORA1 to establish species-specific pharmacology profiles .

What techniques can be used to study ADORA1 interaction with other signaling molecules?

Investigating ADORA1 interactions with other signaling molecules requires specialized techniques:

  • Co-immunoprecipitation: Using selective antibodies for ADORA1 (available as recombinant monoclonal antibodies with various conjugations including biotin, HRP, and FITC) to pull down receptor complexes and identify interacting partners.

  • BRET/FRET assays: Bioluminescence/Fluorescence Resonance Energy Transfer techniques can detect protein-protein interactions in living cells, useful for studying:

    • Receptor homo- and heterodimerization with other GPCRs

    • Interactions with G proteins and arrestins

    • Recruitment of signaling molecules

  • Proximity ligation assays: Detecting interactions between ADORA1 and other proteins within cells at endogenous expression levels.

  • Crosslinking studies: Chemical crosslinking followed by mass spectrometry to identify interaction interfaces.

  • Functional complementation: Split reporter systems to verify protein-protein interactions.

Studies have shown that ADORA1 activation leads to:

  • Binding of Gi1/2/3 or Go proteins

  • Inhibition of adenylate cyclase

  • Activation of phospholipase C

  • Increased inositol triphosphate/diglyceride concentration

  • Activation of potassium channels

  • Inhibition of N-, P-, and Q-type calcium channels

Each of these interactions can be studied using specific assays designed to measure the relevant functional outcomes.

How is ADORA1 involved in cell-specific responses to hypoxia and oxidative stress?

ADORA1 plays important roles in cellular responses to hypoxia and oxidative stress:

  • Hypoxia-induced regulation: Studies in rat hippocampal slices showed that hypoxia decreases the density of A1AR. This desensitization can be mimicked by 2-chloroadenosine (CADO) and prevented by the A1AR antagonist DPCPX, suggesting that hypoxia leads to increased extracellular adenosine levels and subsequent rapid (<90 min) desensitization of A1AR .

  • Cell-specific responses: In C6 glioma cells subjected to hypoxia (2, 6, and 24h), there is down-regulation of A1AR and up-regulation of A2AAR. This effect depends on adenosine release, as adenosine deaminase blocks it. Interestingly, increased A2AAR expression induced by hypoxia is inhibited by A1AR antagonist DPCPX but not by A2AAR antagonist ZM 241385, indicating cross-regulation between receptor subtypes .

  • Protective mechanisms: Decreased A1AR expression appears to prevent hypoxia-induced ventricular dilatation and white matter loss, suggesting that pharmacological blockade of A1AR may have clinical utility in certain hypoxic conditions .

  • Oxidative stress sensing: Some adenosine receptors serve as sensors of cellular oxidative stress, with signals transmitted by transcription factors such as nuclear factor (NF)-κB to regulate receptor expression .

These findings provide several experimental approaches to study ADORA1 involvement in stress responses across different cell types.

What is the current understanding of ADORA1 oligomerization and how can it be studied?

ADORA1 can form both homo-oligomers and hetero-oligomers with other receptors:

  • Homodimerization: A1AR can form homodimers that may have distinct signaling properties compared to monomeric receptors .

  • Heteromerization partners: A1AR can form functional heteromers with:

    • Other adenosine receptors (particularly A2AAR)

    • Dopamine receptors

    • Other GPCRs

  • Functional consequences: Heteromerization can affect:

    • Ligand binding properties

    • G-protein coupling selectivity

    • Signal transduction pathways

    • Receptor trafficking and internalization

  • Experimental approaches:

    • Resonance energy transfer techniques (BRET/FRET)

    • Proximity ligation assays in native tissues

    • Co-immunoprecipitation with subtype-specific antibodies

    • Functional complementation assays

    • Bimolecular fluorescence complementation

  • Validation methods: Combinations of mutations, chimeric constructs, and interfering peptides that disrupt specific interfaces can help validate protein-protein interaction sites .

Understanding oligomerization is important because it may explain why certain pharmacological effects cannot be attributed to individual receptor subtypes and may provide opportunities for developing more selective therapeutic approaches.

How can ADORA1 research contribute to understanding central nervous system disorders?

ADORA1 research has significant implications for understanding CNS disorders:

  • Neuronal expression patterns: ADORA1 is widely distributed on neurons in the cortex, hippocampus, and cerebellum, where it modulates the release of neurotransmitters including glutamate, acetylcholine, serotonin, and GABA .

  • Glial expression: ADORA1 is also present on astrocytes, oligodendrocytes, and microglia, suggesting roles beyond neuronal signaling . In situ hybridization studies have mapped the expression of Adora1 transcripts in various cell types across laminae in primary auditory cortex .

  • Sleep regulation: A1 receptors participate in sleep promotion by inhibiting arousal of cholinergic neurons in the basal forebrain .

  • Neuroprotection: ADORA1 activation can protect against excitotoxicity, which is relevant to stroke, epilepsy, and neurodegenerative diseases.

  • Experimental approaches:

    • Cell-specific genetic manipulation (conditional knockouts)

    • Optogenetic approaches targeting ADORA1-expressing neurons

    • Pharmacological studies with selective agonists/antagonists

    • Single-cell transcriptomics to identify disease-specific changes in expression

Understanding cell-specific expression patterns has important implications for experimental design when targeting ADORA1 using techniques like optogenetics, gene editing, or pharmacology, as target specificity significantly impacts experimental outcomes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.