Recombinant Human Adenosine receptor A2b (ADORA2B)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Human Adenosine Receptor A2B (ADORA2B)

Recombinant Human ADORA2B is a bioengineered protein representing the human adenosine A2B receptor, a G-protein-coupled receptor (GPCR) encoded by the ADORA2B gene. It is produced via recombinant DNA technology, typically expressed in bacterial systems like E. coli, and is widely used in research to study receptor function, ligand binding, and therapeutic potential.

Pharmacological and Therapeutic Insights

ADORA2B modulates diverse physiological processes, with therapeutic potential in inflammation, pain, and metabolic disorders.

Ligand Interactions

Ligand TypeExample CompoundsEffectSource
AgonistsNECA, BAY-60-6583, LUF-5835Stimulate cAMP; anti-inflammatory
AntagonistsCVT-6883, MRS-1706, PSB-0788Inhibit receptor signaling
Partial AgonistsLUF-5845Moderate receptor activation

ADORA2B agonists like BAY-60-6583 restore cognitive function in midazolam-induced models by upregulating Per2 and C-fos .

Disease Associations

ConditionRole of ADORA2BEvidenceSource
Chronic PainPromotes TRPV1 upregulation via IL-6/sIL-6RSustained adenosine signaling
Insulin ResistanceEnhances hepatic glucose productionObesity models show reduced HGP with ADORA2B blockade
Asthma/Cystic FibrosisRegulates immune responses in lung tissueHigh expression in alveolar epithelial cells

Research Applications and Experimental Findings

ADORA2B is critical in immune regulation and neuroinflammation, with studies highlighting its dual roles:

Anti-Inflammatory Mechanisms

  • Treg Enhancement: ADORA2B activation increases regulatory T-cell differentiation, suppressing pro-inflammatory cytokines (e.g., IL-6, TNF-α) .

  • Chronic Inflammation: Adora2b−/− mice exhibit exacerbated pulmonary inflammation due to impaired Treg induction .

Neurological and Metabolic Roles

  • Cognitive Dysfunction: Midazolam-induced memory deficits correlate with reduced hippocampal Adora2b expression; BAY-60-6583 reverses these effects .

  • Insulin Sensitivity: ADORA2B−/− mice on high-fat diets show reduced adiposity and improved glucose disposal .

Lung Pathophysiology

ADORA2B is highly expressed in murine type II alveolar epithelial cells (AECs), where it regulates surfactant production and cAMP signaling .

Gene and Protein Characteristics

The ADORA2B gene (17p12) encodes a 332-amino acid protein with conserved features across species:

SpeciesChromosomal LocusKey Expression SitesSource
Human17p12Lung, liver, bladder
Mouse11 B2Hippocampus, immune cells
Rat10q23Similar to human distribution

ADORA2B’s paralog, ADORA2A, shares structural homology but distinct tissue distribution and signaling roles .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipments.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ADORA2B; Adenosine receptor A2b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-332
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFA IPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGT RARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMS YMVYFNFFGCVLPPLLIMLVIYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIV GIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYT FHKIISRYLLCQADVKSGNGQAGVQPALGVGL
Uniprot No.

Target Background

Function
Adenosine receptor A2b (ADORA2B) is a G protein-coupled receptor that mediates its activity through G proteins, subsequently activating adenylyl cyclase.
Gene References Into Functions
  1. CD73-dependent elevation of plasma adenosine signaling via ADORA2B-mediated protein kinase A phosphorylation, ubiquitination, and proteasome degradation of erythrocyte ENT1 constitutes a novel feed-forward signaling network underlying initial hypoxic adaptation and retention upon re-exposure. PMID: 28169986
  2. Hypoxia upregulates adenosine receptor 2B (A2BR) expression in human breast cancer cells through the transcriptional activity of hypoxia-inducible factor 1. PMID: 30242135
  3. Findings suggest that hypoxia, via HIF1A, contributes to pulmonary fibrosis development and progression by regulating ADORA2B expression on alternatively activated macrophages, influencing cell differentiation, and the production of profibrotic mediators. PMID: 28701304
  4. The A2b adenosine receptor antagonist PSB-603 promotes oxidative phosphorylation and ROS production in colorectal cancer cells through an adenosine receptor-independent mechanism. PMID: 27693637
  5. This study investigated the effects of TNF-alpha on the expression and responsiveness of the A2B adenosine receptor (A2BAR), a Gs-coupled receptor that promotes mesenchymal stem cell (MSC) differentiation into osteoblasts. PMID: 28137910
  6. Cells lacking A2b do not respond to hypoxia or ATP; however, A2b transfection restores this response, implicating Epac1 and Rap1B in the relative positioning of the centrosome and nucleus. PMID: 27226580
  7. A2b receptor overexpression is observed in various tumor lines and patient biopsies across different cancers, suggesting its potential role in tumor progression. [review] PMID: 27729268
  8. In obese individuals, lower A2bAR, KLF4, and KLF15 expression levels in visceral adipose tissue may correlate with obese-dyslipidemia-induced inflammation in the Uygur population. PMID: 27199507
  9. Erythrocyte AMP-activated protein kinase, a key protein downstream of the A2B adenosine receptor, is activated in humans at high altitude, phosphorylating and activating BPG mutase, thereby inducing 2,3-BPG production and O2 release from erythrocytes. PMID: 27482003
  10. A2B receptor activation is crucial for adenosine's stimulatory effect on IL-10 production and suppression of nitric oxide release. PMID: 26748211
  11. ADORA2B mRNA and protein are significantly upregulated in oral squamous cell carcinoma (OSCC), controlling cellular proliferation via HIF-1alpha activation, suggesting a key role in tumoral progression in OSCCs. PMID: 26228921
  12. ADORA2B is a target gene of miR-128b, which represses cell proliferation, migration, and invasion and promotes apoptosis by targeting ADORA2B in gastric cancer. PMID: 26478435
  13. A2B receptor activation-driven angiogenesis via cAMP-PKA-CREB mediates VEGF production and PI3K/AKT-dependent upregulation of eNOS in HMEC-1. PMID: 25966978
  14. The rs7208480 of ADORA2B and its haplotypes showed no association with chronic heart failure susceptibility. PMID: 25629231
  15. Adenosine A2b signaling represses CIITA transcription in VSMCs by modulating the interaction between STAT1 and the epigenetic machinery. PMID: 25765819
  16. Post-myocardial infarction, A2B receptor signaling regulates myocardial repair and remodeling. PMID: 24584483
  17. Adenosine A2B receptor activation is regulated by the C-terminus of G protein alpha-subunits. PMID: 24464644
  18. The adenosine A2b receptor is uniquely induced by ischemia in both mice and humans, playing a role in ischemic pre- or post-conditioning. PMID: 24502579
  19. A2B receptor activation blunts trophoblast migration, possibly due to reduced MAPK signaling pathway activation and lower proMMP-2 levels. PMID: 25002363
  20. The adenosine A2b receptor (ADORA2B) is essential for adenosine-induced SphK1 activity in human and mouse normal and sickle erythrocytes in vitro. PMID: 25587035
  21. A2BAR plays a potentially destructive role under intestinal ischemia/reperfusion and acute hypoxic conditions. PMID: 24966910
  22. The A2bAR regulates adipocyte differentiation, with the A2bAR-KLF4 axis potentially modulating adipose biology. PMID: 24928509
  23. Preeclampsia HUVECs exhibit elevated A2BAR protein levels and impaired A2BAR-mediated NO/VEGF signaling. PMID: 24877077
  24. ADORA2B is the specific receptor and signaling pathway for the metabolite 5'-methylthioadenosine (MTA). PMID: 25087184
  25. High extracellular adenosine concentrations in the tumor microenvironment chronically activate A2B receptors, suppressing Rap1B prenylation and signaling, reducing cell-cell contact, and promoting cell scattering. PMID: 23716716
  26. ADORA2B is induced in lung cells after cyclic mechanical stress, with a promoter region conveying stretch responsiveness and a HIF-1 binding site. PMID: 24391213
  27. A2B receptor-dependent upregulation of JunB plays a role in VEGF production and potentially other AP-1-regulated events. PMID: 24136993
  28. Remodeled vessels in pulmonary hypertension associated with COPD show increased adenosine A2B receptor expression and hyaluronan deposition. PMID: 23855769
  29. Hypoxia-induced serotonin synthesis and secretion is amplified by ADORA2B signaling via MAPK/CREB and TPH-1 activation. PMID: 23638125
  30. CD73 promotes renal adenosine production, a driver of renal hypertension via enhanced ADORA2B signaling-mediated endothelin-1 induction in a hypoxia-inducible factor-alpha-dependent manner. PMID: 23584256
  31. A2B receptors are expressed in neuroendocrine tumors during cellular stress, damage, and hypoxia. PMID: 22119961
  32. This review discusses the role of ADORA2B and its potential therapeutic relevance. [Review Article] PMID: 22963436
  33. A pharmacologically tractable Fra-1/ADORA2B axis promotes breast cancer metastasis. PMID: 23483055
  34. A(2B)AR binding to specific p105 sites prevents p105 polyubiquitylation and degradation. PMID: 22767505
  35. The A2bAR significantly regulates HFD-induced hallmarks of T2D, suggesting therapeutic potential. PMID: 22848385
  36. This study explores distinct interactions of structurally diverse ligands with the human A(2B) receptor and differences between closely related receptor subtypes. PMID: 23286920
  37. A(2B)ARs mediate C. difficile toxin-induced enteritis and disease. PMID: 23045479
  38. ADORA2B is a candidate gene modifying sickle cell disease severity. PMID: 22679008
  39. A(1) and A(2B) adenosine receptors may serve as biomarkers for spontaneous abortion (SA) risk, and their stimulation might improve fetoplacental perfusion by increasing VEGF and NO. PMID: 22867902
  40. [review] ADORA2B receptor activation exhibits cardioprotective effects; however, the optimal timing for activation remains debated. PMID: 21335481
  41. Adenosine stimulates human endothelial progenitor cell migration by activating A2A and A1, but not A2B, receptors, supporting adenosine's role in modulating hEPC angiogenic capacity. PMID: 22217884
  42. Adenosine-elicited Per2 stabilization controls HIF-dependent cardiac metabolism and ischemia tolerance. PMID: 22504483
  43. 2',3'-cAMP inhibits vascular smooth muscle cell proliferation, partly through 2',3'-cAMP metabolism to adenosine, engaging the A2B receptor. PMID: 21622827
  44. Only the adenosine A2B receptor's disulfide bond is essential for ligand binding and receptor activation. PMID: 21620804
  45. Differences in the dynamic behaviors of A(2A)AR and A(2B)AR receptors are explained by their sequences, loop lengths, and disulfide bridges. PMID: 21480628
  46. Adenosine A(B) receptors mediate early NR4A1 induction and decreased cell proliferation via the cAMP/Epac pathway in coronary artery smooth muscle cells. PMID: 21109603
  47. Transgenic A2BR blockade reduces circulating interleukin (IL)-6 levels, potentially due to reduced bacterial load. PMID: 21242513
  48. Deterioration in GPCR extracellular domains compromises receptor structure, impacting activation and constitutive activity. PMID: 21030693
  49. ADORA2B is overexpressed in hypoxic colorectal carcinomas, potentially promoting cancer cell growth. PMID: 20619442
  50. TNF-alpha-induced A(2B)AR expression in colonic epithelial cells is post-transcriptionally regulated by miR27b and miR128a. PMID: 20388705
Database Links

HGNC: 264

OMIM: 600446

KEGG: hsa:136

STRING: 9606.ENSP00000304501

UniGene: Hs.167046

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What distinguishes ADORA2B from other adenosine receptors?

ADORA2B is unique among the four adenosine receptors (A1, A2A, A2B, A3) in two critical aspects. First, it requires significantly higher adenosine concentrations for activation compared to other adenosine receptors, with levels typically achieved during hypoxic inflammation. Second, ADORA2B is transcriptionally induced during hypoxia or inflammation through the hypoxia-inducible transcription factor HIF1A, making its expression highest during these physiological states . These properties position ADORA2B as a specialized receptor particularly adapted for hypoxic conditions, unlike the constitutively expressed Adora1, Adora2a, and Adora3 receptors which respond to lower adenosine concentrations under normal physiological conditions.

How do experimental models assess ADORA2B function?

ADORA2B function can be evaluated through several complementary approaches:

  • Cellular assays: FLIPR assays measure intracellular calcium mobilization in Chinese Hamster Ovary (CHO-K1) cell lines stably transfected with human A2B receptors . This approach provides rapid assessment of receptor activation.

  • Genetic models: Conditional knockout mice (ADORA2B f/f-Transgelin (Tagln) cre mice) allow tissue-specific deletion of ADORA2B, particularly in vascular smooth muscle cells, enabling assessment of receptor function in specific cell types .

  • Hypoxia challenge models: Exposure to hypoxic conditions (10% O₂) combined with SUGEN (SU5416) for 28 days (HX-SU) provides a relevant physiological context for studying ADORA2B function in pulmonary hypertension development .

  • Bleomycin models: Administration of chronic low doses of bleomycin (0.035U/kg/b.w. IP) induces both lung fibrosis and pulmonary hypertension, allowing researchers to evaluate ADORA2B's role in these interrelated pathological processes .

How should researchers design experiments to accurately measure ADORA2B-specific responses?

When designing experiments to measure ADORA2B-specific responses, researchers should implement a multi-faceted approach that accounts for this receptor's unique properties:

Recommended Experimental Design Protocol:

  • Pharmacological validation: Use selective ADORA2B agonists (e.g., BAY 60-6583) and antagonists (e.g., GS-6201) to confirm receptor specificity. Important controls include testing responses under both normoxic and hypoxic conditions, as ADORA2B responses are often augmented under hypoxia .

  • Genetic validation: Employ conditional knockout models or siRNA approaches targeting ADORA2B to confirm receptor-specific effects. The ADORA2B f/f-Tagln cre mouse model has been particularly useful for studying vascular smooth muscle-specific ADORA2B functions .

  • Physiological relevance: Conduct experiments under conditions that achieve adenosine concentrations sufficient to activate ADORA2B (higher than required for other adenosine receptors). Remember that ADORA2B requires higher adenosine concentrations for activation compared to other adenosine receptors .

  • Readout selection: Measure both immediate signaling responses (calcium flux using FLIPR) and downstream effects (gene expression changes of IL-6, HAS2, Tgm2) to capture the full spectrum of ADORA2B activity .

  • Time-course analysis: Monitor responses over extended periods to capture both acute signaling and delayed transcriptional effects, particularly as ADORA2B itself is transcriptionally regulated by HIF1A under hypoxic conditions .

What are the current technical challenges in studying ADORA2B-netrin-1 interactions?

The netrin-1/ADORA2B axis represents an exciting frontier in adenosine receptor biology, with several technical challenges that researchers must address:

  • Specificity demonstration: Proving direct versus indirect interactions between netrin-1 and ADORA2B requires careful experimental design. Techniques like surface plasmon resonance or proximity ligation assays can help establish direct binding, while co-immunoprecipitation studies might identify intermediate molecules in the signaling complex .

  • Context-dependent effects: Netrin-1 was originally identified as a neuronal guidance molecule but subsequently shown to have immune-modulatory functions. Researchers must carefully control for cell type-specific effects when studying this interaction .

  • Temporal dynamics: Understanding whether netrin-1 acts as a fast signaling molecule or initiates slower transcriptional programs requires time-course experiments with appropriate controls for each time point.

  • Physiological relevance: Determining whether netrin-1 levels achieved in vivo are sufficient to activate ADORA2B signaling requires careful quantification of local tissue concentrations during different physiological and pathological states.

  • Pathway cross-talk: Netrin-1 can activate multiple receptors and pathways, necessitating careful isolation of ADORA2B-specific effects through genetic approaches or selective pharmacological tools.

How can researchers accurately distinguish ADORA2B-specific effects from other adenosine receptors in pulmonary hypertension models?

Distinguishing ADORA2B-specific effects from other adenosine receptors in pulmonary hypertension models requires multiple complementary approaches:

Methodological Framework:

  • Pharmacological approach: Use selective agonists and antagonists with careful dose-response studies. For example, BAY 60-6583 (ADORA2B agonist) and GS-6201 (ADORA2B antagonist) have been validated in pulmonary artery smooth muscle cell studies .

  • Cell-specific conditional knockouts: Utilize transgenic models with cell-specific deletion of ADORA2B. The ADORA2B f/f-Tagln cre mouse model specifically deletes ADORA2B in vascular smooth muscle cells, allowing researchers to isolate ADORA2B functions in this cell type during pulmonary hypertension development .

  • Comparative receptor expression analysis: Quantify expression levels of all four adenosine receptors in relevant tissues and cell types. Studies have shown increased levels of ADORA2B specifically in pulmonary artery smooth muscle cells from idiopathic pulmonary arterial hypertension patients .

  • Downstream mediator analysis: Focus on known ADORA2B-specific downstream mediators. In pulmonary hypertension, these include:

    • Hyaluronan synthase 2 (HAS2)

    • Interleukin-6 (IL-6)

    • Tissue transglutaminase (Tgm2)

  • Hypoxia response analysis: Examine responses under both normoxic and hypoxic conditions. ADORA2B-mediated upregulation of HAS2 and IL-6 is significantly augmented under hypoxic conditions, while Tgm2 upregulation is more prominent under normoxic conditions .

What controls are essential when evaluating ADORA2B activation in recombinant systems?

When evaluating ADORA2B activation in recombinant systems, researchers must implement comprehensive controls to ensure valid and reproducible results:

Essential Controls Table:

Control TypePurposeImplementation
Vehicle controlAccount for non-specific effects of solventsMatch solvent composition and concentration without active compound
Untransfected/empty vector controlDistinguish receptor-dependent from independent effectsParallel experiments in cells lacking ADORA2B expression
Receptor expression verificationEnsure consistent receptor expression levelsWestern blot, qPCR, or flow cytometry quantification before each experiment
Positive control receptorBenchmark signaling responsesParallel experiments with well-characterized GPCRs like β2-adrenergic receptor
Adenosine degradation controlPrevent interference from adenosine metabolismInclude adenosine deaminase inhibitors when using adenosine as agonist
Oxygen tension controlAccount for ADORA2B's hypoxia sensitivityCompare responses under defined normoxic (21% O2) vs. hypoxic (1-5% O2) conditions
Signal transduction pathway validationConfirm expected downstream signalingUse pathway-specific inhibitors (e.g., PKA inhibitors for cAMP pathway)

These controls are particularly important given ADORA2B's unique characteristics, including its lower affinity for adenosine requiring higher concentrations for activation and its differential responses under normoxic versus hypoxic conditions .

How should researchers interpret contradictory data between in vitro ADORA2B studies and in vivo disease models?

Contradictory findings between in vitro ADORA2B studies and in vivo disease models are common in adenosine receptor research and require careful interpretation:

  • Context-dependent expression: ADORA2B expression is highly regulated by hypoxia through HIF1A. Verify whether the in vitro conditions match the in vivo hypoxic environment in terms of receptor expression levels .

  • Cell type-specific effects: ADORA2B functions differently across cell types. For example, while ADORA2B deletion in vascular smooth muscle cells prevents pulmonary hypertension, it doesn't affect fibrotic deposition in bleomycin-exposed mice, likely due to ADORA2B's different roles in fibroblasts and myeloid cells .

  • Compensatory mechanisms: In vivo, other adenosine receptors may compensate for ADORA2B function or alterations. Compare phenotypes of global ADORA2B knockout versus conditional cell-specific knockout models .

  • Temporal considerations: Acute versus chronic receptor activation may yield opposite effects. Design time-course experiments that capture both immediate signaling and long-term adaptations .

  • Systemic feedback loops: In vivo models involve complex interorgan communication that in vitro systems cannot replicate. Consider using co-culture systems or ex vivo tissue preparations as intermediate models .

  • Pharmacokinetic factors: Drug distribution, metabolism, and clearance in vivo may result in different effective concentrations compared to in vitro conditions. Measuring tissue drug concentrations can help reconcile these differences.

What is the current evidence for targeting ADORA2B in pulmonary hypertension therapy?

Current evidence strongly supports ADORA2B as a potential therapeutic target in pulmonary hypertension:

  • Expression pattern: Elevated ADORA2B levels have been observed in pulmonary artery smooth muscle cells (PASMCs) from patients with idiopathic pulmonary arterial hypertension (iPAH) .

  • Genetic evidence: Mice with conditional deletion of ADORA2B in vascular smooth muscle cells (ADORA2B f/f-Tagln cre mice) were protected from developing pulmonary hypertension in both hypoxia-SUGEN and bleomycin-induced models .

  • Signaling mechanisms: ADORA2B activation in PASMCs promotes a pro-remodeling phenotype through:

    • Increased hyaluronan production via upregulation of hyaluronan synthase 2 (HAS2)

    • Enhanced inflammation through interleukin-6 (IL-6) induction

    • Activation of tissue transglutaminase (Tgm2)

  • Environmental interaction: ADORA2B-mediated effects are amplified under hypoxic conditions, with increased responses for HAS2 and IL-6 expression in hypoxia compared to normoxia .

  • Pharmacological intervention: ADORA2B antagonists like GS-6201 can inhibit the pro-remodeling responses induced by ADORA2B activation in PASMCs, particularly under hypoxic conditions .

This body of evidence suggests that ADORA2B antagonists could represent a novel therapeutic approach for pulmonary arterial hypertension, particularly in the context of hypoxia-associated disease.

How do ADORA2B-mediated responses differ between acute and chronic hypoxic conditions?

ADORA2B-mediated responses show significant differences between acute and chronic hypoxic conditions, reflecting the receptor's adaptive role in different timeframes:

Acute Hypoxia Responses:

  • Rapid calcium signaling: Activation of ADORA2B under acute hypoxia triggers calcium mobilization, which can be measured using FLIPR assays with Ca2+-sensitive dyes like Fluo-3-AM .

  • Immediate vasodilation: Short-term ADORA2B activation can cause vasodilation to improve oxygen delivery to hypoxic tissues.

  • Enhanced adenosine production: Acute hypoxia rapidly increases extracellular adenosine levels through inhibition of adenosine kinase and enhanced CD39/CD73 activity.

Chronic Hypoxia Responses:

  • Receptor upregulation: Extended hypoxia induces ADORA2B expression through HIF1A-mediated transcriptional activation .

  • Pro-remodeling mediator induction: Chronic ADORA2B activation in pulmonary vascular smooth muscle cells upregulates:

    • Hyaluronan synthase 2 (HAS2)

    • Interleukin-6 (IL-6)

    • Tissue transglutaminase (Tgm2)

  • Vascular remodeling: Sustained activation contributes to muscularization of pulmonary arteries and development of pulmonary hypertension .

  • Altered signaling sensitivity: Prolonged hypoxia enhances the magnitude of ADORA2B-mediated responses, with significantly augmented HAS2 and IL-6 induction compared to normoxic conditions .

These temporal differences highlight the dual nature of ADORA2B signaling—initially protective but potentially detrimental when chronically activated—and suggest different therapeutic approaches might be needed depending on disease stage.

What experimental approaches can differentiate direct versus indirect effects of ADORA2B activation?

Differentiating direct versus indirect effects of ADORA2B activation requires sophisticated experimental approaches:

  • Temporal resolution studies:

    • Implement high-temporal resolution measurements (seconds to minutes) to capture immediate receptor-proximal events

    • Compare to delayed responses (hours to days) that may involve transcriptional programs

    • Use protein synthesis inhibitors (cycloheximide) to distinguish primary from secondary effects

  • Pathway dissection:

    • Apply selective inhibitors at different levels of the signaling cascade

    • For example, use PKA inhibitors to block cAMP-dependent pathways or calcium chelators for calcium-dependent pathways

    • Measure outcomes at each step to construct signaling hierarchies

  • Cell-specific approaches:

    • Employ conditional knockout models with inducible promoters (e.g., tamoxifen-inducible Cre-loxP systems)

    • Use cell type-specific ADORA2B knockdown with siRNA or CRISPR technologies

    • ADORA2B f/f-Tagln cre mice have successfully demonstrated direct receptor effects in vascular smooth muscle cells

  • Ex vivo and co-culture systems:

    • Isolate primary cells from specific tissues to assess direct receptor activation

    • Implement co-culture models to evaluate intercellular communication

    • Compare responses in isolated cells versus intact tissue preparations

  • Transcriptomic and proteomic time-course analysis:

    • Perform RNA-seq at multiple time points after receptor activation

    • Use bioinformatic approaches to cluster immediate-early versus delayed response genes

    • Validate direct transcriptional targets using chromatin immunoprecipitation (ChIP)

What expression systems yield optimal functional recombinant human ADORA2B?

Optimizing functional expression of recombinant human ADORA2B requires careful consideration of expression systems:

Comparison of Expression Systems for ADORA2B:

Expression SystemAdvantagesLimitationsOptimization Strategies
CHO-K1 cellsWell-established for GPCR expression; demonstrated utility in FLIPR assays for ADORA2B May lack some human-specific post-translational modificationsStable transfection with antibiotic selection; clone screening for expression level
HEK293 cellsHuman-derived; efficient transfection; appropriate post-translational modificationsLower expression levels than specialized systemsCodon optimization; use of strong promoters (CMV); inducible expression systems
Sf9 insect cellsHigh expression levels; suitable for structural studiesGlycosylation patterns differ from mammalsBaculovirus expression optimization; membrane fraction isolation protocols
Yeast (Pichia pastoris)Cost-effective; scalable; handling of toxic proteinsLimited post-translational modificationsCodon optimization; temperature optimization; methanol induction protocols
Cell-free systemsRapid production; avoids cell toxicity issuesLower yields; requires membrane mimeticsOptimized translation factors; nanodiscs or liposomes for membrane proteins

For functional studies, mammalian expression systems (particularly CHO-K1 cells) have demonstrated success in producing ADORA2B suitable for pharmacological characterization using techniques like FLIPR . Key considerations include:

  • Expression level verification: Quantify receptor density using radioligand binding assays or fluorescent antibody labeling

  • Functional coupling assessment: Verify signal transduction through both cAMP and calcium pathways

  • Stability determination: Monitor expression levels and functional responses over multiple passages

What are the critical parameters for designing ADORA2B functional assays?

Designing robust functional assays for ADORA2B requires optimization of multiple parameters:

  • Assay format selection:

    • FLIPR calcium mobilization: Optimal for measuring rapid ADORA2B responses, using Ca2+-sensitive dyes like Fluo-3-AM

    • cAMP accumulation: Appropriate for Gs-coupled responses using HTRF, ELISA, or luminescence-based detection

    • Impedance-based systems: Captures integrated cellular responses over longer timeframes

    • Microphysiometer analysis: Allows real-time measurements of cellular metabolism changes upon receptor activation

  • Pharmacological considerations:

    • Agonist selection: Choose between endogenous ligand (adenosine) or selective ADORA2B agonists (BAY 60-6583)

    • Concentration range: Account for ADORA2B's lower affinity requiring higher adenosine concentrations (compared to other adenosine receptors)

    • Antagonist controls: Include selective antagonists (GS-6201) to confirm receptor specificity

  • Experimental conditions optimization:

    • Buffer composition: Minimize phosphate to prevent ATP/adenosine metabolism

    • Temperature control: Maintain consistent temperature throughout the assay

    • Cell density: Optimize for signal-to-noise ratio while maintaining physiological relevance

    • Oxygen tension: Compare normoxic versus hypoxic conditions, as ADORA2B responses are amplified under hypoxia

  • Signal detection parameters:

    • Temporal resolution: Capture both immediate (seconds to minutes) and extended (hours) responses

    • Dynamic range optimization: Adjust detector sensitivity to accommodate signal magnitude

    • Signal normalization: Account for variations in cell number and receptor expression

  • Data analysis approaches:

    • Dose-response modeling: Fit appropriate models (four-parameter logistic) to determine EC50/IC50 values

    • Kinetic analysis: Evaluate both magnitude and rate of response for complex signaling patterns

    • Statistical validation: Implement appropriate statistical tests with correction for multiple comparisons

How might single-cell analysis technologies advance our understanding of ADORA2B heterogeneity?

Single-cell technologies offer unprecedented potential to unravel ADORA2B functional heterogeneity across different cell populations:

  • Single-cell RNA sequencing applications:

    • Identify cell subpopulations with varying ADORA2B expression levels within tissues affected by pulmonary hypertension

    • Map co-expression patterns of ADORA2B with other receptors and signaling components

    • Track transcriptional changes following hypoxia exposure at single-cell resolution

    • Discover novel ADORA2B-regulated genes through correlation analysis

  • Single-cell protein analysis approaches:

    • Mass cytometry (CyTOF) to quantify ADORA2B protein levels alongside activation markers

    • Single-cell western blotting to measure ADORA2B expression variability and post-translational modifications

    • Proximity ligation assays to detect ADORA2B interactions with netrin-1 at single-cell resolution

  • Functional single-cell techniques:

    • Microfluidic calcium imaging to measure ADORA2B activation dynamics in individual cells

    • Single-cell impedance measurements to characterize cell-specific responses to ADORA2B agonists

    • Correlation of receptor expression with functional outcomes at single-cell resolution

  • Integrative multi-omics approaches:

    • Combined single-cell transcriptomics and proteomics to link ADORA2B expression to functional phenotypes

    • Spatial transcriptomics to map ADORA2B expression patterns within tissue architecture

    • Integration with clinical data to identify patient-specific ADORA2B expression patterns

These approaches could resolve currently conflicting data by revealing how ADORA2B function varies across cell types and states, potentially identifying specific cellular targets for therapeutic intervention in pulmonary hypertension and other ADORA2B-mediated conditions.

What therapeutic potential exists for biased ADORA2B ligands in treating pulmonary hypertension?

Biased ADORA2B ligands represent an exciting frontier in developing targeted therapies for pulmonary hypertension:

  • Rationale for biased signaling approaches:

    • ADORA2B activates multiple signaling pathways, including cAMP and calcium mobilization

    • Different downstream pathways may mediate beneficial versus detrimental effects

    • In pulmonary hypertension, ADORA2B activation increases expression of pro-remodeling factors including IL-6, HAS2, and Tgm2

    • Biased ligands could selectively activate beneficial pathways while avoiding those promoting vascular remodeling

  • Potential therapeutic advantages:

    • Pathway selectivity: Target specific signaling cascades rather than blocking all receptor functions

    • Reduced side effects: Minimize off-target effects in other tissues expressing ADORA2B

    • Context-specific activity: Design ligands with enhanced activity under hypoxic conditions

  • Development challenges:

    • Identifying which signaling pathways mediate beneficial versus detrimental effects

    • Developing high-throughput screening assays for pathway-specific activation

    • Optimizing pharmacokinetic properties for pulmonary targeting

    • Validating biased ligands in appropriate disease models

  • Experimental approaches:

    • Systematic structure-activity relationship studies of ADORA2B ligands

    • Parallel assessment of multiple signaling pathways (cAMP, calcium, β-arrestin recruitment)

    • Correlation of pathway activation profiles with effects on IL-6, HAS2, and Tgm2 expression

    • Testing in both normoxic and hypoxic conditions to evaluate context-dependent signaling

Given that ADORA2B deletion in vascular smooth muscle cells prevents pulmonary hypertension development in multiple models , biased ligands represent a promising approach to achieve the benefits of targeted ADORA2B modulation while minimizing potential side effects associated with complete receptor blockade.

What are the most critical unresolved questions regarding ADORA2B function in pulmonary vascular disease?

Despite significant advances in understanding ADORA2B biology, several critical questions remain unresolved:

  • Cell type-specific contributions: While ADORA2B in vascular smooth muscle cells clearly contributes to pulmonary hypertension development , the relative importance of ADORA2B signaling in endothelial cells, fibroblasts, and immune cells remains incompletely understood.

  • Temporal dynamics: The transition point at which ADORA2B signaling shifts from adaptive to maladaptive during chronic hypoxia exposure requires further elucidation.

  • Downstream effector hierarchy: The relative importance of IL-6, hyaluronan, and Tgm2 in mediating ADORA2B's effects on vascular remodeling needs clarification .

  • Environmental interactions: How ADORA2B signaling interacts with other hypoxia-responsive pathways and inflammatory mediators remains to be fully characterized.

  • Therapeutic targeting specificity: Development of approaches that selectively target pathological ADORA2B signaling while preserving beneficial functions requires further research.

What methodological approaches will accelerate translation of ADORA2B research to clinical applications?

To accelerate translation of ADORA2B research to clinical applications, researchers should consider the following methodological approaches:

  • Human tissue validation studies:

    • Expand analyses of ADORA2B expression and activation in patient-derived samples

    • Develop biomarker panels to identify patients likely to benefit from ADORA2B-targeted therapies

    • Establish patient-derived organoid models to test therapeutic approaches

  • Improved animal models:

    • Develop humanized mouse models expressing human ADORA2B

    • Implement inducible, cell-specific ADORA2B modulation to study stage-specific interventions

    • Utilize large animal models that better recapitulate human pulmonary vascular physiology

  • Advanced pharmacological tools:

    • Design ADORA2B antagonists with improved selectivity and pharmacokinetic properties

    • Develop biased ligands that selectively modulate specific ADORA2B signaling pathways

    • Create PET tracers for ADORA2B to enable in vivo receptor occupancy studies

  • Combinatorial therapeutic approaches:

    • Test ADORA2B modulators in combination with current standard-of-care treatments

    • Explore synergistic effects with other pathway-specific interventions

    • Develop precision medicine approaches based on patient-specific ADORA2B expression patterns

  • Biomarker development:

    • Identify circulating markers of ADORA2B activation that correlate with disease activity

    • Develop imaging approaches to visualize ADORA2B-dependent processes non-invasively

    • Establish predictive biomarkers for response to ADORA2B-targeted therapies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.