Recombinant Human Adenosine receptor A3 (ADORA3)

Shipped with Ice Packs
In Stock

Description

Functional Roles and Signaling Pathways

ADORA3 couples primarily to Gαi/o proteins, mediating:

  • Cardioprotection: Attenuates ischemia-reperfusion injury via RhoA–phospholipase D1 and PI3K/Akt pathways .

  • Anti-inflammatory effects: Inhibits neutrophil degranulation and cytokine release .

  • Cancer regulation: Suppresses proliferation in hepatocellular carcinoma and melanoma .

Key signaling outcomes:

  • ↓ cAMP via Gαi-mediated adenylyl cyclase inhibition .

  • ↑ Phospholipase C (PLC) activity, elevating intracellular Ca²⁺ .

  • Activation of ERK1/2 and p38 MAPK pathways .

Pharmacological Agents and Selectivity

ADORA3 ligands show high subtype specificity, critical for minimizing off-target effects:

Table 2: Selective ADORA3 Ligands

ClassExamplesClinical StatusSource
AgonistsCF101 (IB-MECA), CF102Phase III (rheumatoid arthritis, psoriasis)
AntagonistsMRS1523, MRS1220Preclinical studies
PAMs*LUF6000, MRS3558Investigational (neuropathic pain)

*PAMs: Positive allosteric modulators

Clinical and Therapeutic Applications

A. Rheumatoid Arthritis (RA):

  • CF101 (IB-MECA) achieved ACR20/50/70 responses in 55.6%, 33.3%, and 11.5% of patients, respectively, in a Phase II trial .

  • ADORA3 overexpression correlates with therapeutic response, suggesting utility as a biomarker .

B. Oncology:

  • Preclinical models show ADORA3 agonists induce apoptosis in breast cancer and glioblastoma cells .

  • Overexpressed in hepatocellular carcinoma, enabling targeted therapy .

C. Cardiovascular Disease:

  • Agonists like CP-532,903 reduce infarct size by 40–60% in rodent ischemia models .

Research Advancements

  • Cryo-EM structures of ADORA3 bound to CF101/CF102 revealed ligand-specific orientations of 3-iodobenzyl groups, informing drug design .

  • Species-specific pharmacology: Human ADORA3 exhibits distinct ligand-binding kinetics compared to mouse homologs, necessitating humanized models .

  • Dual allosteric modulation: Imidazoquinoline derivatives (e.g., LUF6000) enhance adenosine signaling via orthosteric and intracellular sites .

Challenges and Future Directions

  • Side effect mitigation: Early agonists caused transient hypotension; newer agents (e.g., CF102) show improved safety .

  • Biomarker development: ADORA3 expression levels in PBMCs predict therapeutic response in RA .

  • Disease-specific targeting: Ongoing trials explore ADORA3 modulation in non-alcoholic steatohepatitis (NASH) and chronic pain .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your needs when placing your order. We will prepare according to your demand.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
Full length protein
Target Names
Target Protein Sequence
MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC VVCHPSDSLDTSIEKNSE
Uniprot No.

Q&A

What is the basic structure of human ADORA3?

Human ADORA3 is a G protein-coupled receptor characterized by seven transmembrane domains and an intracellular C-terminal region containing Ser and Thr residues that serve as potential phosphorylation sites. The gene encoding ADORA3 is located on human chromosome 1p21-p13 and consists of a single chain of 318 amino acids with two exons separated by a single intron of approximately 2.2 kb . The receptor's structure includes a highly conserved Trp (W6.48) in transmembrane domain 6 that is essential for maintaining the active conformation necessary for signal transduction .

What are the primary signaling pathways associated with ADORA3?

ADORA3 primarily couples to Gi/Gq proteins and is involved in various intracellular signaling cascades. Upon activation, it inhibits adenylyl cyclase and regulates mitogen-activated protein kinase (MAPK) pathways, leading to modulation of gene transcription . Following agonist stimulation, ADORA3 undergoes phosphorylation at the C-terminus by GPCR kinases and subsequent internalization through clathrin-coated pits . This receptor affects functions of nearly all immune cells and influences the proliferation of cancer cells through these pathways .

What are the most effective methods for expressing recombinant human ADORA3 in vitro?

Recombinant human ADORA3 expression can be optimized through several approaches:

  • Mammalian Expression Systems: HEK293 and CHO cell lines transfected with ADORA3 cDNA using lipofection or viral vectors provide proper post-translational modifications.

  • Insect Cell Expression: Baculovirus-infected Sf9 or High Five cells can yield higher protein quantities while maintaining proper folding.

  • Expression Optimization: Consider using codon-optimized sequences, adding stabilizing mutations (particularly at the C-terminus), and incorporating purification tags (His6 or FLAG) that don't interfere with ligand binding sites.

  • Solubilization Techniques: Use mild detergents (DDM, LMNG) or lipid nanodiscs to maintain native conformation during extraction from membranes.

When designing expression constructs, avoid truncating the C-terminal region, as it contains critical phosphorylation sites required for proper desensitization and internalization pathways .

What analytical techniques are most suitable for characterizing ADORA3-ligand interactions?

Several complementary techniques provide comprehensive characterization of ADORA3-ligand interactions:

  • Radioligand Binding Assays: Competitive binding assays using [125I]I-AB-MECA or [3H]HEMADO as tracers provide accurate Ki values.

  • Surface Plasmon Resonance (SPR): Offers real-time, label-free measurement of association/dissociation kinetics (kon and koff rates).

  • Thermodynamic Analysis: Isothermal titration calorimetry (ITC) reveals the energetics of ligand binding, providing insights into enthalpy/entropy contributions .

  • Functional Assays: cAMP accumulation assays (inhibition), GTPγS binding, and β-arrestin recruitment assays help distinguish between full agonists, partial agonists, and antagonists.

  • Fluorescence-Based Techniques: Fluorescent ADORA3 agonists allow for visualization of receptor-arrestin complex colocalization during internalization .

For thermodynamic characterization, note that the parameters of ligand binding at ADORA3 are similar to other adenosine receptors within either agonist or antagonist classes, reflecting common interaction mechanisms that explain the difficulty in designing selective adenosine ligands .

How does the desensitization mechanism of ADORA3 compare to other adenosine receptors?

ADORA3 undergoes rapid desensitization through a distinct mechanism compared to other adenosine receptors:

  • Phosphorylation-Dependent Process: Following agonist stimulation, ADORA3 is phosphorylated at Ser and Thr residues in the C-terminus by GPCR kinases .

  • β-Arrestin Recruitment: The conserved Trp (W6.48) in TM6 is essential for the active conformation that enables interaction with β-arrestin2 .

  • Internalization Pathway: After phosphorylation, ADORA3 undergoes internalization through clathrin-coated pits, which can be visualized using fluorescent A3AR agonists that colocalize with internalized receptor-arrestin complexes .

  • Recovery Rate: ADORA3 shows faster desensitization kinetics compared to A1 and A2A receptors but slower resensitization, which impacts the duration of therapeutic effects when targeting this receptor.

What are the key structural determinants for selective ligand binding to ADORA3?

The selective binding of ligands to ADORA3 depends on specific structural elements:

  • Key Modification Sites: Affinity and selectivity of agonists are primarily based on substitutions at the C2, N6, and 5′ positions of adenosine .

  • Ribose Modifications: Only limited ribose functional group substitution is tolerated at ADORA3. Some potent agonists like compound 13 contain a 3′-amino-3′-deoxy modification of adenosine, though this modification is not universally applicable .

  • Binding Pocket Characteristics: The binding pocket of ADORA3 contains specific residues that differ from other adenosine receptors, allowing for selective interactions with appropriately designed ligands.

  • Efficacy Determinants: Binding Ki values are not directly predictive of in vivo protective responses. Parameters such as half-life, duration of response, and maximal efficacy in vivo must be considered when developing selective ADORA3 modulators .

How does ADORA3 contribute to inflammatory disease mechanisms?

ADORA3 plays a complex role in inflammatory processes through several mechanisms:

  • Immune Cell Modulation: ADORA3 affects functions of almost all immune cells, making it a key regulator in inflammation .

  • Cardioprotective Function: It mediates sustained cardioprotective effects during cardiac ischemia .

  • Neutrophil Regulation: ADORA3 is involved in inhibiting neutrophil degranulation in neutrophil-mediated tissue injury .

  • Dual Role in Neuroinflammation: It has been implicated in both neuroprotective and neurodegenerative effects, depending on the context and cell type .

  • Cell Fate Decisions: ADORA3 may mediate both cell proliferation and cell death, contributing to the complexity of its role in inflammatory diseases .

Recent research indicates that targeting ADORA3 with appropriate modulators may provide safe and efficacious treatments for inflammatory conditions such as rheumatoid arthritis and psoriasis .

What is the evidence supporting ADORA3 as a target for cancer therapy?

ADORA3 shows promising potential as a cancer therapy target:

  • Differential Expression: ADORA3 is significantly overexpressed in various cancer cells compared to healthy cells, making it a selective target .

  • Genomic Analysis: Data from cancer databases show that in 393 unique genomic analyses of cancerous tumors, 25 showed significant increases in ADORA3 expression compared to normal tissue, with particularly strong upregulation in glioblastoma and astrocytoma .

  • Cell Proliferation Control: ADORA3 influences cancer cell proliferation through regulation of MAPK pathways and transcription modulation .

  • Clinical Progress: The selective ADORA3 agonist 2-chloro-N6-(3-iodobenzyl)-adenosine-5′-N-methyluronamide (Cl-IB-MECA; CF102/Namodenoson) has progressed to advanced clinical trials for liver cancer treatment .

  • Safety Profile: Clinical studies have found ADORA3 agonists to be safe and well-tolerated, with promising results in specific cancer types .

What are the current challenges in developing selective ADORA3 modulators?

Developing selective ADORA3 modulators faces several challenges:

  • Structural Similarity: The high structural similarity between adenosine receptor subtypes makes achieving selectivity difficult. The thermodynamic parameters of ligand binding are similar across all adenosine receptors within either agonist or antagonist classes .

  • Species Differences: Large species differences in receptor pharmacology complicate translational research. Compounds showing high selectivity in one species may exhibit different profiles in others .

  • In Vitro vs. In Vivo Correlation: Binding affinity (Ki values) does not directly predict in vivo efficacy. Phenotypic screening in appropriate disease models is necessary to identify truly effective compounds .

  • Pharmacokinetic Challenges: Many nucleoside-based ADORA3 agonists have suboptimal pharmacokinetic properties that limit their clinical applicability.

  • Complex Signaling: ADORA3 signaling involves multiple pathways and can produce seemingly contradictory effects (e.g., both neuroprotective and neurodegenerative outcomes), requiring thorough characterization of pathway-specific effects .

How can researchers effectively use ADORA3 as a biomarker in personalized medicine approaches?

ADORA3 shows promise as a biomarker for personalized medicine:

  • Expression Profiling: Quantitative assessment of ADORA3 expression levels in patient samples can help predict response to A3AR-targeted therapies.

  • Genetic Variants: Variants of ADORA3 have been associated with coronary heart disease, autism spectrum disorder, and aspirin-induced urticaria, suggesting genetic screening may help identify suitable patient populations .

  • miRNA Regulation: The 3′-UTR of ADORA3 mRNA is targeted by proinflammatory microRNA (miR-206) in ulcerative colitis, leading to downregulation of ADORA3 expression. Assessing miRNA profiles might provide additional predictive value .

  • Combination Biomarkers: Combining ADORA3 expression data with other inflammatory or oncogenic markers may improve predictive accuracy for treatment outcomes.

  • Treatment Monitoring: Longitudinal assessment of ADORA3 expression during treatment could guide therapy adjustments and predict resistance development.

What phenotypic screening approaches are most effective for evaluating ADORA3 modulators?

Effective phenotypic screening approaches for ADORA3 modulators include:

  • Chronic Neuropathic Pain Models: The chronic constriction injury (CCI) model of Bennett and Xie has proven valuable for evaluating the efficacy of ADORA3 agonists in reducing hyperalgesia with high potency and long duration of action .

  • Inflammation Assays: Models of rheumatoid arthritis and psoriasis provide relevant contexts for evaluating ADORA3 modulators, as these conditions have shown promise in clinical trials with selective agonists .

  • Cancer Cell Proliferation: Assays measuring effects on cancer cell proliferation, especially in liver cancer and glioblastoma cell lines where ADORA3 is overexpressed.

  • Immune Cell Function: Assessing neutrophil degranulation, cytokine production, and other immune parameters can provide insights into anti-inflammatory efficacy.

  • Combined Approaches: Integrating biochemical assays (receptor binding, signaling pathway activation) with phenotypic outcomes provides a more comprehensive assessment of compound activity and mechanism.

The phenotypic screen in the CCI model has proven particularly valuable for guiding structure-activity relationship studies, as it accounts for pharmacokinetic factors and provides data on efficacy and duration of action after oral administration, indirectly indicating favorable bioavailability .

What are the optimal approaches for studying ADORA3 pharmacology across species?

To address species differences in ADORA3 pharmacology:

  • Multi-Species Receptor Characterization: Test compounds against recombinant ADORA3 from multiple species (human, mouse, rat, dog) to establish cross-species activity profiles.

  • Ortholog-Specific Binding Studies: Conduct comparative binding studies with selective radioligands to identify key pharmacological differences between species orthologs.

  • Humanized Animal Models: Consider using humanized mouse models expressing human ADORA3 for more predictive preclinical studies.

  • Structural Analysis: Perform comparative structural analysis of binding sites across species to identify critical residues responsible for pharmacological differences.

  • Translational Biomarkers: Develop biomarkers that translate across species to bridge preclinical and clinical studies.

This approach is particularly important as diverse classes of ADORA3 antagonists have shown large species differences in pharmacology .

What are the key structure-activity relationships for developing selective ADORA3 agonists?

The development of selective ADORA3 agonists is guided by specific structure-activity relationships:

PositionModificationEffect on ADORA3 Activity
C2Small substituentsMaintains activity and may enhance selectivity
N63-Iodobenzyl groupSignificantly enhances A3 selectivity
5′N-methyluronamideImproves potency and selectivity
RiboseLimited modificationsMost modifications reduce activity
3′3′-amino-3′-deoxySome potent agonists retain this modification

Key examples of selective ADORA3 agonists that have progressed to clinical trials include:

  • IB-MECA (CF101/Piclidenoson): N6-(3-Iodobenzyl)adenosine-5′-N-methyluronamide, in clinical trials for rheumatoid arthritis and psoriasis .

  • Cl-IB-MECA (CF102/Namodenoson): 2-chloro-N6-(3-iodobenzyl)-adenosine-5′-N-methyluronamide, in development for liver cancer treatment .

  • CP-532,903: Demonstrated cardioprotective effects in a mouse model of infarction .

The efficacy of these compounds is determined not just by receptor binding affinity but by pharmacokinetic properties that influence in vivo half-life and duration of action .

How do antagonists and allosteric modulators differ in their ADORA3 binding mechanisms?

Antagonists and allosteric modulators interact with ADORA3 through distinct mechanisms:

  • Orthosteric Antagonists:

    • Compete directly with agonists at the primary binding site

    • Often derived from nucleoside structures with modifications that suppress efficacy, particularly through ribose moiety alterations

    • Examples include MRS-1220, MRS-1523, and VUF-5574

  • Allosteric Modulators:

    • Bind to sites distinct from the orthosteric binding pocket

    • Positive allosteric modulators (PAMs) like LUF-6000 enhance the action of agonists without directly activating the receptor

    • Negative allosteric modulators (NAMs) reduce receptor activation through conformational changes

    • May offer greater selectivity due to lower conservation of allosteric sites between receptor subtypes

  • Binding Site Differences:

    • Orthosteric site is located within the transmembrane domain bundle

    • Allosteric sites may be located at the extracellular loops, intracellular face, or transmembrane interfaces

    • The conserved Trp (W6.48) in TM6 plays a crucial role in transmitting conformational changes upon ligand binding

This mechanistic diversity offers multiple approaches for therapeutic modulation of ADORA3 activity with potentially different pharmacological outcomes.

What emerging technologies show promise for advancing ADORA3 research?

Several cutting-edge technologies hold promise for advancing ADORA3 research:

  • Cryo-EM Structural Analysis: High-resolution structural determination of ADORA3 in complex with various ligands could provide unprecedented insights into binding mechanisms and guide structure-based drug design.

  • CRISPR-Cas9 Genome Editing: Precise modification of ADORA3 in cellular and animal models enables detailed investigation of specific receptor domains and signaling pathways.

  • Single-Cell Analysis: Characterizing ADORA3 expression and function at the single-cell level in heterogeneous tissues provides nuanced understanding of cell type-specific roles.

  • AI-Driven Drug Design: Machine learning approaches integrating structural, pharmacological, and clinical data to accelerate the development of selective ADORA3 modulators.

  • Biased Signaling Exploration: Development of biased ADORA3 ligands that selectively activate beneficial pathways while minimizing unwanted effects.

How might combination therapies incorporating ADORA3 modulators improve treatment outcomes?

Combination therapy approaches with ADORA3 modulators show significant potential:

  • Synergistic Anti-inflammatory Effects: Combining ADORA3 agonists with traditional DMARDs or biologics for enhanced efficacy in rheumatoid arthritis and psoriasis.

  • Cancer Treatment Combinations: ADORA3 modulators may sensitize cancer cells to chemotherapy or immunotherapy, potentially allowing dose reduction of toxic agents.

  • Neuropathic Pain Management: ADORA3 agonists combined with other analgesics could provide superior pain relief with reduced side effects, given their high potency in chronic neuropathic pain models .

  • Cardioprotective Strategies: Leveraging the cardioprotective effects of ADORA3 activation during ischemia in combination with standard treatments for cardiac conditions.

  • Personalized Combination Approaches: Utilizing ADORA3 as both a therapeutic target and a biological predictive marker to guide personalized combination therapy selection .

These combination approaches require careful investigation of pharmacokinetic and pharmacodynamic interactions between ADORA3 modulators and other therapeutic agents.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.