Recombinant Human adenovirus B serotype 35 Early E3 18.5 kDa glycoprotein

Shipped with Ice Packs
In Stock

Description

Protein Composition

  • Molecular Weight: 18.5 kDa (predicted), with observed variations due to glycosylation .

  • Amino Acid Sequence: Comprises residues 20–166 of the native protein, including a conserved region critical for MHC class I binding . Key residues (e.g., Asp-107, Met-110) are essential for structural stability and function .

  • Domains:

    • N-terminal His-tag: Facilitates purification in recombinant forms .

    • Transmembrane Domain: Truncated in recombinant versions without loss of MHC binding capability .

    • Conserved Region (residues 90–110): Mediates interaction with MHC class I .

Biological Role in Immune Evasion

The E3-18.5K glycoprotein binds MHC class I molecules in the endoplasmic reticulum, preventing their transport to the cell surface. This mechanism shields adenovirus-infected cells from cytotoxic T-lymphocyte detection .

Key Findings:

  1. MHC Class I Binding:

    • Deletion of the transmembrane domain or cytoplasmic tail does not impair binding, but removal of 11 residues (including the conserved region) abolishes it .

    • Mutations at Asp-107 or Met-110 disrupt binding, confirming their functional importance .

  2. Serotype-Specific Features:

    • Ad35 E3-18.5K shares limited homology with group C adenoviruses (e.g., Ad2) but retains conserved cysteine residues critical for disulfide bonding .

    • Unique to group B adenoviruses, Ad35 E3-18.5K is associated with infections in immunocompromised hosts .

Vaccine Development

  • Vector Engineering: Recombinant Ad35 (rAd35) vectors lacking E3 are used for high-capacity vaccine platforms (up to 7.6 kb transgene capacity) .

  • Prime-Boost Strategies: rAd35 primes robust CD8+ T-cell responses when combined with protein antigens (e.g., malaria vaccines) .

Table 2: Recombinant Ad35 E3-18.5K in Assays

ApplicationMethodologyOutcome
Binding AssaysFunctional ELISA Confirms MHC class I interaction
ImmunofluorescenceIn vivo imaging Localizes protein in lymph nodes
Western BlotAnti-His/EGFP antibodies Validates expression (~22.6 kDa)

Wild-Type vs. Recombinant E3-18.5K

FeatureWild-TypeRecombinant
GlycosylationExtensive (29 kDa observed) Minimal (E. coli expression)
MHC BindingRetained in ER Retained (in vitro assays)
Host InteractionsImmune evasion in vivo Tool for mechanistic studies

Research Implications

  • Immune Evasion Studies: Truncated or mutated recombinant forms clarify structural determinants of MHC binding .

  • Therapeutic Design: Insights into Ad35’s tropism for immunocompromised hosts inform targeted vector engineering .

  • Limitations: Lack of glycosylation in E. coli-expressed protein may alter antigenicity compared to native forms .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requests. Please indicate your preference in the order notes and we will fulfill it to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for precise delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of that tag.
Synonyms
Early E3 18.5 kDa glycoprotein; E3-19K; E3gp 19 kDa; E19; GP19K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-166
Protein Length
Full Length of Mature Protein
Species
Human adenovirus B serotype 35 (HAdV-35) (Human adenovirus 35)
Target Protein Sequence
NYDPCLDFDPENCTLTFAPDTSRICGVLIKCGWECRSVEITHNNKTWNNTLSTTWEPGVPEWYTVSVRGPDGSIRISNNTFIFSEMCDLAMFMSKQYSLWPPSKDNIVTFSIAYCLCACLLTALLCVCIHLLVTTRIKNANNKEKMP
Uniprot No.

Target Background

Function
This protein binds and retains class I heavy chains in the endoplasmic reticulum during the early stages of virus infection. This hinders their transport to the cell surface, impairing immune recognition. Additionally, it delays the expression of class I alleles that it cannot directly affect through retention. The protein also interacts with transporters associated with antigen processing (TAP) and functions as a tapasin inhibitor, preventing class I/TAP association. Consequently, infected cells are effectively shielded from detection by cytotoxic T-lymphocytes.
Protein Families
Adenoviridae E19 family
Subcellular Location
Host endoplasmic reticulum membrane; Single-pass type I membrane protein.

Q&A

What is the primary function of the Early E3 18.5 kDa glycoprotein in adenoviruses?

The primary function of the Early E3 18.5 kDa glycoprotein is to bind and retain class I heavy chains of the major histocompatibility complex (MHC) in the endoplasmic reticulum during the early period of virus infection. This retention mechanism significantly impairs the transport of MHC class I molecules to the cell surface, effectively preventing infected cells from presenting viral antigens to cytotoxic T lymphocytes (CTLs) . This immunomodulatory activity represents a sophisticated viral immune evasion strategy that helps adenoviruses establish infection and potentially persist longer in the host. The glycoprotein specifically targets the heavy chain component of class I antigens, as demonstrated through affinity chromatography and immunoprecipitation studies .

How does the E3 region contribute to adenovirus pathogenesis?

While none of the E3 gene products are essential for viral replication in vitro, the E3 region plays a critical role in the pathogenesis of adenovirus disease in vivo. Studies using cotton rat (Sigmodon hispidus) models of adenovirus pneumonia have demonstrated that mutants with largely deleted E3 regions (H2dl801 and H5dl327) replicate like wild-type virus but induce a markedly increased lymphocyte and macrophage/monocyte inflammatory response . Specifically, mutations that prevent production of the 19-kDa glycoprotein result in increased pathogenic effects, while mutants with deletions in other E3 open reading frames maintain pathogenic properties similar to wild-type virus . This indicates that the 19-kDa glycoprotein's ability to reduce MHC class I expression on infected cells is directly correlated with modulation of the host immune response.

How conserved are E3 glycoproteins across different adenovirus species?

The E3 region shows significant variability between adenovirus species but remains relatively conserved within each species . This variability suggests that distinct sets of immunomodulatory E3 proteins influence the interaction with the human host and contribute to different disease patterns among adenovirus species . For example, species D adenoviruses uniquely express E3/49K, a protein that functions differently from the E3 proteins found in other species . The high polymorphism observed in E3 proteins, particularly in species D adenoviruses, suggests these proteins are under strong evolutionary pressure, likely due to their exposure to immunological interference mechanisms .

What are the molecular mechanisms of MHC class I downregulation by E3 glycoproteins?

The Early E3 18.5 kDa glycoprotein employs a sophisticated molecular mechanism to downregulate MHC class I presentation. After synthesis as a type I transmembrane protein, the glycoprotein specifically binds to newly synthesized MHC class I heavy chains in the endoplasmic reticulum, forming stable complexes that prevent the normal assembly and transport of MHC class I molecules . This retention mechanism operates during the early period of virus infection, creating a window during which infected cells have significantly reduced surface expression of MHC class I molecules, thereby becoming less detectable by virus-specific CTLs. The glycoprotein can also delay the expression of class I alleles that it cannot directly retain, suggesting multiple mechanisms of interference with antigen presentation pathways .

How do species-specific E3 proteins differ in their immunomodulatory strategies?

Different adenovirus species have evolved distinct E3 protein repertoires with unique immunomodulatory functions. While species C adenoviruses express E3 proteins that act directly on infected cells to prevent MHC class I presentation, species D adenoviruses encode the unique E3/49K protein that targets noninfected cells . E3/49K is initially synthesized as an 80-100 kDa transmembrane protein that is subsequently cleaved, with the large ectodomain (sec49K) being secreted. This secreted protein specifically binds to the cell surface protein tyrosine phosphatase CD45 on all primary leukocytes, suppressing the activation and function of natural killer cells, T cells, and B cells . This represents a fundamentally different immune evasion strategy that allows species D adenoviruses to modulate immune responses distant from the site of infection.

What is the impact of E3 glycoprotein polymorphisms on viral pathogenesis?

The E3 glycoproteins, particularly the species D E3/49K protein, exhibit the highest polymorphism of the entire proteome of species D adenoviruses, suggesting intense evolutionary pressure . This polymorphism likely impacts viral pathogenesis and tissue tropism. For example, species D adenoviruses are frequently associated with ocular pathologies, and the variability in their E3 proteins may contribute to their specific tissue tropism and disease manifestations . Despite this high variability, functional studies have demonstrated that the critical immunomodulatory activities, such as CD45 binding by species D E3/49K proteins, are conserved features regardless of the pathological associations of the respective adenovirus types .

What expression systems are optimal for producing recombinant E3 glycoproteins?

Based on the available research, E. coli expression systems with N-terminal His-tag modifications have been successfully employed to produce recombinant E3 glycoproteins with good yield and purity (>90% as determined by SDS-PAGE) . When designing expression constructs, careful consideration should be given to the inclusion of signal sequences and potential glycosylation sites if mammalian post-translational modifications are desired. For functional studies requiring fully glycosylated proteins, mammalian expression systems may be preferable, though they typically yield lower protein amounts. Researchers should select the expression system based on the specific experimental requirements, balancing protein yield with the need for proper folding and post-translational modifications.

How can the interaction between E3 glycoproteins and MHC class I molecules be quantitatively measured?

Multiple complementary approaches can be employed to quantitatively assess E3 glycoprotein-MHC class I interactions:

  • In vitro affinity chromatography: This technique has successfully demonstrated specific binding between viral glycoproteins and the heavy chain of class I antigens .

  • Immunoprecipitation assays: These assays can detect co-precipitation of viral glycoproteins with class I antigens, confirming their physical association .

  • Functional ELISA: The biological activity of recombinant E3 glycoproteins can be determined by their binding ability in a functional ELISA .

  • Flow cytometry: This approach can quantify the reduction in cell surface MHC class I expression in the presence of E3 glycoproteins.

When implementing these methods, it is crucial to include appropriate controls, such as mutant glycoproteins with altered binding domains, to confirm the specificity of the observed interactions.

What in vivo models are suitable for studying E3 glycoprotein functions?

The cotton rat (Sigmodon hispidus) has proven to be a valuable animal model for investigating adenovirus pneumonia and studying the role of E3 proteins in pathogenesis . This model permits investigation of viral gene products required for disease progression and the molecular mechanisms driving tissue damage. Studies using this model have demonstrated that E3-deleted adenovirus mutants induce enhanced inflammatory responses compared to wild-type viruses, highlighting the immunomodulatory role of E3 proteins in vivo .

For studying the effect of E3 proteins on gene therapy applications, the Gunn rat model of hyperbilirubinemia has been utilized. Recombinant adenoviruses containing both E3 and therapeutic genes (such as human bilirubin-uridine-diphosphoglucuronate-glucuronosyltransferase) demonstrated prolonged expression and successful readministration, unlike E3-deleted vectors . This model provides evidence that inclusion of E3 genes in recombinant adenoviruses can facilitate readministration of functional vectors for long-term correction of inherited metabolic disorders.

How should experiments be designed to differentiate between E3 glycoprotein effects on different immune cell populations?

When investigating the immunomodulatory effects of E3 glycoproteins, particularly those targeting multiple immune cell types like the species D E3/49K protein, experiments should be carefully designed to differentiate between effects on various immune cell populations:

  • Cell-type isolation and purification: Use magnetic or fluorescence-activated cell sorting to obtain pure populations of T cells, B cells, NK cells, and other leukocyte subsets.

  • Cell-type specific activation assays: For each cell type, employ specific activation protocols:

    • T cells: Anti-CD3/CD28 stimulation or antigen-specific activation

    • B cells: Anti-IgM stimulation or CD40L+IL-4 treatment

    • NK cells: IL-2/IL-15 stimulation or target cell co-culture

  • Functional readouts: Select appropriate readouts for each cell type:

    • T cells: Proliferation, cytokine production, cytotoxicity

    • B cells: BCR signaling, antibody production, proliferation

    • NK cells: Cytotoxicity against target cells, cytokine production

Recent studies have demonstrated that species D E3/49K not only affects T and NK cells but also directly inhibits B cell receptor signaling . By using cell-type specific assays, researchers can comprehensively characterize the range of immunomodulatory effects exhibited by these viral proteins.

How can contradictory results between in vitro and in vivo studies be reconciled?

Discrepancies between in vitro and in vivo studies of E3 glycoproteins can arise from several factors:

  • Complexity of the immune environment: In vivo systems involve complex interactions between multiple cell types and cytokine networks that may not be replicated in vitro.

  • Concentration differences: The concentration of E3 proteins achieved in vitro may differ significantly from physiological concentrations during natural infection.

  • Timing factors: The temporal dynamics of immune responses in vivo are difficult to model in vitro.

To reconcile contradictory results:

  • Use ex vivo approaches: Isolate primary cells from infected animals for functional assays to bridge the gap between in vitro and in vivo findings.

  • Employ 3D culture systems or organoids: These more closely mimic the tissue architecture found in vivo.

  • Develop mathematical models: These can help integrate data from different experimental systems and predict outcomes under various conditions.

  • Consider host genetic factors: Differences in host genetics between in vitro cell lines and in vivo models may account for some discrepancies.

When reporting contradictory results, researchers should clearly describe the experimental conditions and discuss potential reasons for the observed differences.

How do E3 glycoproteins from different adenovirus species compare in structure and function?

E3 glycoproteins from different adenovirus species share some structural features but exhibit distinct functional properties, as summarized in the table below:

FeatureSpecies C (HAdV-5/6) E3 18.5-19 kDaSpecies D E3/49KSpecies B (HAdV-35) E3 18.5 kDa
StructureType I transmembrane glycoprotein Type I transmembrane glycoprotein with cleaved, secreted ectodomain Type I transmembrane glycoprotein (predicted)
Primary targetMHC class I heavy chains CD45 on leukocytes Likely MHC class I (based on homology)
MechanismRetention of MHC I in ER Binds to CD45, suppresses immune cell activation Presumed ER retention of MHC I
Cellular localizationPrimarily ER-resident Cell surface and secreted Presumably ER-resident
Effect on immune responsePrevents CTL recognition of infected cells Suppresses NK, T, and B cell activation and function Likely prevents CTL recognition
Role in pathogenesisReduces inflammation in infected tissues Modulates immune response distant from infection site Not specifically characterized

This comparative analysis highlights the diverse strategies employed by different adenovirus species to evade host immune responses, with species C primarily targeting infected cells through MHC I retention, while species D employs a secreted mechanism to affect distant immune cells through CD45 binding.

What are the key differences in experimental approaches when studying membrane-bound versus secreted E3 proteins?

The distinct properties of membrane-bound E3 proteins (like species C E3 18.5-19 kDa) versus secreted E3 proteins (like species D E3/49K) necessitate different experimental approaches:

For membrane-bound E3 proteins:

  • Subcellular localization studies: Confocal microscopy with ER markers to confirm retention of the protein and its target MHC I molecules.

  • Cell surface MHC I quantification: Flow cytometry to measure reduced MHC I expression on infected cells.

  • Intracellular trafficking assays: Pulse-chase experiments to track the impaired transport of MHC I molecules.

  • CTL recognition assays: Measuring the susceptibility of infected cells to CTL-mediated killing.

For secreted E3 proteins:

  • Protein secretion assays: ELISA or Western blotting of culture supernatants to quantify protein release.

  • Receptor binding studies: Flow cytometry to measure binding to target cells, receptor identification using knockout cells or blocking antibodies.

  • Trans-inhibition assays: Testing the effect of secreted proteins on non-infected immune cells.

  • 3D migration assays: Evaluating the impact on immune cell recruitment and tissue infiltration.

These tailored approaches allow researchers to comprehensively characterize the distinct mechanisms by which different E3 proteins modulate host immune responses.

Why might recombinant E3 glycoproteins show reduced activity in functional assays?

Several factors can contribute to reduced activity of recombinant E3 glycoproteins in functional assays:

  • Improper folding: E3 glycoproteins expressed in bacterial systems may lack proper folding compared to those produced in mammalian cells, affecting their functional activity.

  • Absence of post-translational modifications: The lack of glycosylation in bacterial expression systems can significantly impact protein function, particularly for glycoproteins that require these modifications for receptor binding.

  • Protein aggregation: During purification or storage, recombinant proteins may form aggregates that reduce their effective concentration and accessibility to binding partners.

  • N- or C-terminal tags: His-tags or other fusion tags may interfere with protein function, particularly if located near binding domains.

  • Buffer composition: Suboptimal buffer conditions (pH, salt concentration, presence of divalent cations) can affect protein stability and activity.

To troubleshoot these issues, researchers can:

  • Compare expression in bacterial versus mammalian systems

  • Test tag-free protein versions

  • Optimize buffer conditions for stability and activity

  • Validate proper folding using circular dichroism or limited proteolysis

  • Confirm glycosylation status using glycan-specific staining or mass spectrometry

How can researchers address contradictory data in E3 glycoprotein immunomodulatory studies?

When faced with contradictory data regarding E3 glycoprotein functions, researchers should systematically evaluate:

  • Protein source variability: Different recombinant protein preparations may exhibit varying activities. Standardization of protein production, purification, and quality control is essential.

  • Cell line differences: The effect of E3 glycoproteins may vary between cell lines due to differences in receptor expression or signaling pathway components.

  • Experimental readout sensitivity: Different assays measuring the same biological process may have varying sensitivities, potentially leading to discrepant results.

  • Temporal factors: The timing of measurements can significantly affect results, particularly for dynamic processes like cell signaling or activation.

  • Concentration-dependent effects: E3 glycoproteins may exhibit different or even opposing effects at different concentrations.

To address these challenges:

  • Include multiple complementary assays to measure the same biological effect

  • Test a range of protein concentrations to identify potential dose-dependent effects

  • Use primary cells from multiple donors to account for genetic variability

  • Employ time-course experiments to capture the full dynamics of the biological process

  • Thoroughly document experimental conditions to enable accurate replication

How can advanced structural biology techniques enhance our understanding of E3 glycoprotein functions?

Advanced structural biology techniques offer promising avenues for deepening our understanding of E3 glycoprotein functions:

  • Cryo-electron microscopy (cryo-EM): This technique could reveal the three-dimensional structure of E3 glycoproteins in complex with their binding partners (MHC I or CD45), providing insights into the molecular basis of these interactions.

  • X-ray crystallography: While challenging for membrane proteins, this approach could provide atomic-resolution structures of E3 glycoprotein functional domains.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can identify conformational changes upon binding and map interaction interfaces between E3 glycoproteins and their targets.

  • Single-molecule Förster resonance energy transfer (FRET): This approach could reveal dynamic conformational changes in E3 glycoproteins during their interaction with binding partners.

  • AlphaFold and other AI-based structure prediction tools: These computational approaches can generate predicted structures to guide experimental design, particularly for less-characterized E3 proteins like those from adenovirus B serotype 35.

These structural insights would not only advance our fundamental understanding of viral immune evasion mechanisms but could also inform the design of targeted inhibitors or modified adenoviral vectors for gene therapy applications.

What potential applications exist for engineered E3 glycoproteins in immunotherapy and gene therapy?

E3 glycoproteins offer several promising applications in immunotherapy and gene therapy:

  • Enhanced gene therapy vectors: Incorporating E3 genes into adenoviral vectors has been shown to inhibit antiviral immune responses, allowing for successful readministration and prolonged therapeutic gene expression . This approach could significantly enhance the efficacy of adenovirus-based gene therapies for inherited metabolic disorders.

  • Immunomodulatory biologics: Engineered versions of secreted E3 proteins like E3/49K could be developed as targeted immunosuppressive agents for treating autoimmune diseases or preventing transplant rejection.

  • Novel research tools: E3 proteins that target specific immune receptors, such as E3/49K binding to CD45, represent valuable tools for investigating receptor-specific functions . These proteins could be engineered for enhanced specificity or labeled for tracking receptor dynamics.

  • Oncolytic virus enhancement: Modifying the E3 region in oncolytic adenoviruses could optimize their immunomodulatory properties to enhance tumor-specific immune responses while evading premature viral clearance.

  • Vaccine adjuvants: Modified E3 proteins could potentially serve as adjuvants to enhance or direct specific aspects of the immune response to vaccination.

Realizing these applications will require detailed characterization of the structure-function relationships of E3 glycoproteins and careful engineering to achieve the desired immunomodulatory properties while minimizing off-target effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.