Recombinant Human adenovirus B serotype 7 Early E3B 14.9 kDa protein

Shipped with Ice Packs
In Stock

Description

Introduction to Human Adenovirus B Serotype 7 Early E3B 14.9 kDa Protein

Human Adenovirus B serotype 7 (HAdV-7) is a significant pathogen associated with severe acute lower respiratory tract infections, particularly in children . Within the genome of HAdV-7, the early transcription unit 3 (E3) region encodes several proteins with immunomodulatory functions, including the E3B 14.9 kDa protein. The E3 region is relatively variable among different adenovirus species but conserved within each species, suggesting its importance in viral adaptation to host immune responses . Although the E3 region is not essential for viral replication in vitro, it appears to play a crucial role in viral fitness and pathogenesis in vivo, as evidenced by its conservation across all human adenoviruses . The E3B 14.9 kDa protein belongs to the conserved region 1 (CR1) family of viral proteins, which consists primarily of type I membrane glycoproteins found in human and primate adenoviruses as well as cytomegaloviruses .

Expression System and Purification

The commercially available Recombinant Full Length Human adenovirus B serotype 7 Early E3B 14.9 kDa protein is produced using an Escherichia coli expression system . The recombinant protein is engineered with an N-terminal histidine (His) tag to facilitate purification through affinity chromatography techniques . After expression and purification, the product is typically presented as a lyophilized powder with greater than 90% purity as determined by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) .

Role in Immune Evasion

The E3 region of adenoviruses, including the E3B 14.9 kDa protein, is widely recognized for its immunomodulatory functions that help the virus evade host immune responses . While the specific mechanisms of the E3B 14.9 kDa protein are not fully characterized in the provided search results, related E3 proteins from adenoviruses have been shown to inhibit various immune processes, including antigen presentation, apoptosis, and inflammatory responses .

B Cell Receptor Signaling Inhibition

Research on related E3 proteins, specifically E3/49K, has demonstrated significant effects on immune cell signaling. E3/49K has been shown to bind to CD45 expressing leukocytes, including B cells, and inhibit B cell receptor (BCR) signaling . This inhibition results in reduced calcium flux responses and impaired Erk1/2 phosphorylation following BCR cross-linking, suggesting a mechanism by which adenoviruses can suppress adaptive immune responses . While these findings specifically relate to E3/49K, they provide insights into potential mechanisms by which the E3B 14.9 kDa protein might also modulate host immunity.

Reconstitution Protocol

Table 2: Reconstitution and Storage Recommendations

ParameterRecommendation
ReconstitutionBriefly centrifuge vial before opening; reconstitute in deionized sterile water to 0.1-1.0 mg/mL
StabilizationAdd glycerol to 5-50% final concentration (50% recommended)
Long-term StorageStore aliquots at -20°C/-80°C
Freeze-ThawAvoid repeated freeze-thaw cycles
Working StorageKeep working aliquots at 4°C for up to one week

The recommended reconstitution procedure involves briefly centrifuging the vial prior to opening to bring contents to the bottom, followed by reconstituting the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage, the addition of glycerol to a final concentration of 5-50% (with 50% being the standard recommendation) is advised before aliquoting and storing at -20°C/-80°C .

Current Applications

The Recombinant Human adenovirus B serotype 7 Early E3B 14.9 kDa protein serves as a valuable tool for various research applications, including:

  1. Studying viral immunomodulatory mechanisms

  2. Investigating host-pathogen interactions

  3. Developing antiviral strategies targeting immune evasion mechanisms

  4. Analyzing protein-protein interactions in viral infection processes

  5. Serving as antigens for antibody production and immunological assays

Role in Viral Pathogenesis

Understanding the function of the E3B 14.9 kDa protein in viral pathogenesis could provide insights into the mechanisms by which HAdV-7 causes severe respiratory infections, particularly in pediatric populations . Research on other HAdV-7 proteins has shown that they interact with host cellular machinery to modulate functions such as autophagy, which plays a role in antiviral immunity . Investigation of similar interactions involving the E3B 14.9 kDa protein could reveal additional strategies employed by adenoviruses to manipulate host responses.

Therapeutic Implications

Research on adenovirus immunomodulatory proteins has implications for the development of antiviral therapies and vaccines. Understanding how these proteins interact with host immune components could lead to the design of targeted interventions that prevent immune evasion by the virus . Additionally, recombinant adenoviral proteins with defined immunomodulatory functions might have applications in treating inflammatory or autoimmune conditions where immune suppression is beneficial.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order. We will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Early E3B 14.9 kDa protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-134
Protein Length
Full Length of Mature Protein
Species
Human adenovirus B serotype 7 (HAdV-7) (Human adenovirus 7)
Target Protein Sequence
STATRATPEQLRKCKFQQPWSFLDCYHEKSDFPTYWIVIVGIINILSCTFFSITIYPTFN FGWNSPNALGYPQEPDEHIPLQHIQQPLALVEYENEPQPSLPPAISYFNLTGGDD
Uniprot No.

Target Background

Function
Down-regulates the EGF receptor and prevents cytolysis by TNF.
Protein Families
Adenoviridae E3_14 family
Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

What is the genomic location and structure of the E3B 14.9 kDa protein in HAdV-B7?

The E3B 14.9 kDa protein is encoded within the early transcription unit 3 (E3) of Human adenovirus B serotype 7. The E3 region of adenoviruses is highly conserved among human adenoviruses and contains multiple open reading frames (ORFs). The E3B region specifically codes for three proteins: 10.4K, 14.5K/14.9K, and 14.7K. These proteins are transcribed early during viral infection and do not require viral DNA replication for expression. The 14.9 kDa protein is translated from a distinct ORF within this region, and molecular analysis has confirmed it forms a functional complex with the 10.4K protein .

When studying this protein, researchers should consider that the E3 region undergoes complex splicing patterns, and mutations or deletions in this region can affect the expression of neighboring genes. Experimental design must account for these interactions to avoid misinterpreting results from mutational analyses .

What are the primary functions of the E3B 14.9 kDa protein in viral pathogenesis?

The E3B 14.9 kDa protein, in complex with the 10.4K protein, plays a critical role in viral immune evasion by down-regulating cell surface expression of the apoptosis receptor CD95 (Fas/APO-1). Experimental evidence shows that both the 10.4K and 14.9K proteins are required for this function, as mutation of either gene restores Fas expression on the cell surface .

The protein complex acts by inducing internalization and degradation of Fas, as demonstrated by accumulation of Fas in endosomal/lysosomal vesicles when cells are treated with lysosomotropic agents. This down-regulation protects infected cells from Fas-mediated apoptosis, which represents a key mechanism for adenoviruses to evade host immune responses .

Additionally, the 10.4K-14.9K complex selectively down-regulates certain cell surface receptors, including the epidermal growth factor receptor (EGFR), while not affecting others like the transferrin receptor or CD46. This selectivity suggests a sophisticated mechanism for viral manipulation of host cell signaling .

How does the E3B 14.9 kDa protein interact with other viral and host proteins?

Research indicates that the E3B 14.9 kDa protein forms a physical complex with the 10.4K protein, and both proteins are required for the down-regulation of Fas and other cell surface receptors. Experimental approaches demonstrating this interaction have combined immunoprecipitation with Western blot analysis. When either the 10.4K or 14.9K gene is disrupted, the down-regulation function is lost, confirming that both proteins are necessary for this activity .

The mechanism by which this complex recognizes and targets Fas involves selective interaction with the receptor, leading to its internalization. The complex appears to function in multiple cell types including human lung epithelial cells, cervix carcinoma cells, breast carcinoma cells, and normal human diploid fibroblasts, indicating a conserved mechanism that is not cell type or tissue specific .

What approaches can be used to express and purify recombinant E3B 14.9 kDa protein for functional studies?

For successful expression and purification of the recombinant E3B 14.9 kDa protein, researchers should consider several methodological approaches:

  • Expression systems: Due to the membrane-associated nature of this protein, eukaryotic expression systems like mammalian cells (HEK293, CHO) or insect cells (using baculovirus) are preferable to bacterial systems for obtaining properly folded and processed protein. Bacterial systems may be used for structural studies of soluble domains.

  • Co-expression strategies: Since the 14.9 kDa protein functions in complex with the 10.4K protein, co-expression of both proteins may be necessary for stability and functional studies. This can be achieved using bicistronic expression vectors or co-transfection approaches.

  • Purification tags: Addition of small epitope tags (His, FLAG, HA) at either N- or C-terminus can facilitate purification while minimizing interference with protein function. Tag position should be chosen based on predicted membrane topology to ensure accessibility.

  • Membrane protein extraction: Specialized detergents (CHAPS, DDM, or Triton X-100) are typically required to solubilize membrane-associated proteins while maintaining protein-protein interactions.

Research has utilized stable cell lines expressing mutated forms of the E3 proteins to study their function, demonstrating that selective disruption of individual E3B ORFs by mutating start codons or introducing frame shifts can effectively distinguish the roles of each protein .

What cell culture models are most appropriate for studying E3B 14.9 kDa protein function?

The choice of cell culture model is critical for studying E3B 14.9 kDa protein function. Research has demonstrated successful use of several models:

Cell TypeApplicationsAdvantagesConsiderations
HEK293 cellsTransfection studies, protein expressionHigh transfection efficiency, easy to maintainContains adenovirus E1 region, which may influence results
A549 (lung epithelial)Infection studies, physiological relevanceRelevant to respiratory infections, natural targetVariable expression of cellular receptors
HeLa cellsMechanistic studiesWell-characterized, easy to manipulateMay not fully recapitulate respiratory epithelium
Primary human fibroblasts (MRC-5, SeBu)Physiological relevanceNormal diploid cells, closer to in vivo conditionsMore challenging to transfect, limited lifespan

For studying the specific function of down-regulating Fas expression, cell lines with detectable baseline Fas expression should be selected. The effect has been observed in multiple cell types including lung epithelial cells, cervix carcinoma cells, breast carcinoma cells, and normal human fibroblasts, indicating it is neither cell type nor tissue-specific .

When establishing stable transfectants, careful monitoring of expression levels is essential, as variations in E3 protein expression can affect experimental outcomes. Immunoprecipitation and Western blot analysis have been successfully used to confirm protein expression levels .

What are the recommended methods for detecting and measuring E3B 14.9 kDa protein expression and activity?

Detection and measurement of E3B 14.9 kDa protein expression and activity requires a combination of techniques:

  • Protein detection:

    • Western blot analysis using specific antibodies against the 14.9K protein

    • Immunoprecipitation combined with Western blot for enhanced sensitivity

    • Flow cytometry of permeabilized cells using fluorescently labeled antibodies

  • Functional assays:

    • Flow cytometry to measure surface levels of Fas receptor (primary readout)

    • Apoptosis assays using Fas ligand or agonistic anti-Fas antibodies to measure protection from Fas-mediated cell death

    • Immunofluorescence microscopy to visualize receptor internalization

    • Co-localization studies with endosomal/lysosomal markers in the presence of lysosomotropic agents

  • Complex formation:

    • Co-immunoprecipitation with 10.4K protein

    • Blue native PAGE to preserve protein complexes

    • Proximity ligation assays for in situ detection of protein interactions

Research has shown that the combination of immunoprecipitation with Western blot analysis provides reliable detection of E3 proteins. For functional studies, flow cytometric analysis of surface Fas expression has been established as an effective readout of 10.4K-14.9K activity. The observation that Fas accumulates in endosomal/lysosomal vesicles in the presence of lysosomotropic agents provides additional methodology to study the mechanism of action .

How does the amino acid sequence and structure of HAdV-B7 E3B 14.9 kDa protein compare to homologous proteins in other adenovirus serotypes?

The E3B region is highly conserved among human adenoviruses, though with variations that may impact function and virulence. Comparative analysis shows:

The genome organization of species B adenoviruses like HAdV-B7 contains 39 identified putative coding regions and seven hypothetical coding regions . The E3B 14.9 kDa protein functions in concert with the 10.4K protein, suggesting evolutionary conservation of this functional complex across adenovirus species.

Advanced structural studies using techniques like X-ray crystallography, NMR spectroscopy, or cryo-electron microscopy would provide valuable insights into the protein's three-dimensional structure and help understand the molecular basis for its receptor specificity and function.

What are the molecular mechanisms by which the E3B 14.9 kDa protein complex selectively targets and down-regulates specific cell surface receptors?

The selective targeting of cell surface receptors by the 10.4K-14.9K complex represents a sophisticated mechanism of host manipulation that requires further investigation. Current research indicates:

The complex down-regulates Fas (CD95) and EGFR but does not affect other surface proteins like transferrin receptor or CD46, suggesting a high degree of specificity . This selectivity likely depends on recognition of specific motifs or structural features in the targeted receptors.

The molecular mechanism appears to involve:

  • Recognition of target receptors at the cell surface

  • Induction of receptor internalization

  • Trafficking to endosomal/lysosomal compartments

  • Degradation of the receptor

Research using lysosomotropic agents has shown that Fas accumulates in endosomal/lysosomal vesicles when degradation is inhibited, confirming this trafficking pathway . Advanced research questions should address:

  • What specific motifs in the receptor cytoplasmic domains are recognized by the 10.4K-14.9K complex?

  • Does the complex interact directly with endocytic machinery components?

  • What post-translational modifications of either the viral proteins or target receptors regulate this process?

  • How does the 10.4K-14.9K complex achieve selective recognition of multiple structurally diverse receptors?

Approaches to address these questions could include mutational analysis of receptor cytoplasmic domains, identification of host protein interaction partners using proximity labeling techniques or mass spectrometry, and real-time imaging of receptor trafficking using fluorescently tagged proteins.

How does the HAdV-B7d strain-specific E3B 14.9 kDa protein contribute to the increased virulence observed in recent outbreaks?

Molecular typing has identified HAdV-B7 genome type d (HAdV-B7d) in recent outbreaks, a strain previously identified only in Asia that may be reemerging globally . Research indicates that patients with HAdV-B7 infections were significantly more likely to be adults and to have longer hospital stays compared to those infected with other adenovirus types . This suggests potential strain-specific enhanced virulence that may relate to E3B protein function.

Possible mechanisms by which strain-specific variations in the E3B 14.9 kDa protein might contribute to enhanced virulence include:

  • Altered efficiency of immune evasion through more effective down-regulation of death receptors

  • Expanded receptor targeting repertoire affecting additional host immunoregulatory molecules

  • Modified interaction with host cell machinery leading to enhanced replication

  • Altered tissue tropism or receptor usage affecting virus dissemination

  • Changes in protein stability or expression levels affecting the temporal dynamics of immune evasion

Research approaches to investigate these possibilities could include:

  • Comparative functional studies of E3B 14.9 kDa proteins from different HAdV-B7 genome types

  • Animal models comparing virulence of recombinant viruses with swapped E3B regions

  • Systems biology approaches to identify differential host responses to various HAdV-B7 strains

  • Analysis of clinical isolates for correlations between E3B sequence variations and disease severity

What experimental approaches can be used to study the E3B 14.9 kDa protein in the context of whole-virus infection versus recombinant expression?

Studying the E3B 14.9 kDa protein requires consideration of experimental context, as protein function may differ between recombinant expression systems and natural infection. Research approaches include:

Experimental ContextAdvantagesLimitationsKey Methodologies
Recombinant expressionPrecise control of expression levels, easier manipulation, fewer confounding variablesMay lack viral context important for functionPlasmid transfection, stable cell lines, inducible expression systems
Mutant virus infectionNatural expression context, authentic viral regulatory elementsComplex virus-host interactions may obscure specific protein functionsBacterial artificial chromosome (BAC) recombineering, selective gene disruption
In vitro reconstituted systemsDefined components allow mechanistic insightsMay not recapitulate cellular complexityPurified proteins, liposomes, cell membrane preparations

Research has demonstrated that both approaches can yield valuable insights. Transfection studies with E3 expression plasmids have identified the requirement for both 10.4K and 14.9K proteins in Fas down-regulation . Similarly, infection studies have shown that down-regulation of Fas occurs during natural infection with adenoviruses and confers protection from Fas-mediated apoptosis .

A bacterial artificial chromosome (BAC) strategy has been successfully employed to generate recombinant E1-deleted adenovirus vectors, providing a valuable tool for studying adenovirus-host interactions . This approach allows manipulation of the viral genome while maintaining the genomic context.

What biosafety considerations should researchers address when working with HAdV-B7 and its proteins?

Human Adenovirus B serotype 7 is associated with severe respiratory infections, with recent outbreaks showing significant morbidity including ICU admission (31% of hospitalized patients), mechanical ventilation requirements (18%), and mortality . This pathogenicity necessitates appropriate biosafety measures:

  • Containment Level: HAdV-B7 research typically requires Biosafety Level 2 (BSL-2) facilities and practices. Work with concentrated virus or in animal models may require enhanced BSL-2 practices.

  • Personal Protective Equipment: Standard BSL-2 PPE including lab coats, gloves, and eye protection is essential. Activities that may generate aerosols should be performed in biological safety cabinets.

  • Decontamination: Adenoviruses are relatively resistant to some disinfectants. Effective decontamination requires:

    • 70% ethanol with extended contact time

    • Freshly prepared 10% bleach solution

    • Validated virucidal disinfectants

  • Waste Management: All waste should be appropriately decontaminated before disposal, typically by autoclaving or chemical treatment.

  • Recombinant DNA Considerations: Research involving recombinant adenovirus constructs may require Institutional Biosafety Committee approval and should follow NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules.

When working specifically with recombinant E3B 14.9 kDa protein rather than whole virus, standard BSL-1 practices may be sufficient, but institutional biosafety guidelines should be consulted.

What are the most effective strategies for generating mutations in the E3B 14.9 kDa protein while maintaining the genomic context of other E3 genes?

Generating targeted mutations in the E3B 14.9 kDa protein while preserving the genomic context requires careful consideration of the complex splicing patterns and gene organization in the E3 region. Research has demonstrated effective approaches:

  • Minimal Modifications: Previous research has shown that deletions within the E3B region can profoundly affect splicing, altering expression of other E3 proteins. Successful strategies have employed minimal alterations (1-4 bp insertions) that disrupt protein expression while minimizing impact on splicing patterns .

  • Start Codon Mutation: Mutating the ATG start codon of the 14.9 kDa ORF effectively eliminates protein expression while maintaining the genomic context .

  • Frameshift Introduction: Small insertions that create frameshifts selectively disrupt the targeted ORF without affecting neighboring genes .

  • BAC Recombineering: Bacterial artificial chromosome (BAC) systems allow precise genetic manipulation of large viral genomes. This approach has been successfully used to generate recombinant adenoviruses with modified E3 regions .

  • CRISPR-Cas9 Editing: For cell culture systems expressing E3 proteins, CRISPR-Cas9 can be used to introduce specific mutations into the integrated viral sequences.

Verification of the selective effect of mutations requires demonstrating normal expression of other E3 proteins. Research has successfully used immunoprecipitation, Western blot analysis, and flow cytometry to confirm that introduced mutations selectively eliminated expression of the targeted gene without affecting neighboring genes .

How can researchers effectively differentiate between the functions of the 10.4K and 14.9 kDa proteins that form a functional complex?

Differentiating the specific contributions of the 10.4K and 14.9 kDa proteins to their shared functions presents a significant challenge since they form a functional complex. Research strategies include:

  • Selective Gene Disruption: Mutating either the 10.4K or 14.9K gene individually while maintaining expression of the other has revealed that both proteins are necessary for Fas down-regulation. When either gene is disrupted, Fas expression is restored, indicating complementary but non-redundant functions .

  • Domain Mapping: Creating chimeric proteins or targeted mutations in specific domains can help identify regions responsible for receptor recognition, complex formation, or interaction with cellular trafficking machinery.

  • Co-expression Analysis: Varying expression levels of one protein while keeping the other constant can reveal whether stoichiometric relationships affect function and potentially identify rate-limiting components.

  • Temporal Expression Studies: Controlling the timing of expression using inducible systems may reveal sequence-dependent assembly or function.

  • Structural Biology Approaches: Cross-linking studies, hydrogen-deuterium exchange mass spectrometry, or cryo-electron microscopy of the complex can provide insights into protein-protein interfaces and conformational changes.

Research has shown that immunoprecipitation combined with Western blot analysis can effectively monitor expression of both proteins and confirm their presence or absence in experimental systems . This approach, combined with functional assays measuring Fas surface expression, provides a robust methodology for distinguishing the roles of these proteins.

How can understanding the E3B 14.9 kDa protein function contribute to developing novel antiviral strategies against adenovirus infections?

The E3B 14.9 kDa protein's role in immune evasion, particularly in protecting infected cells from Fas-mediated apoptosis, presents potential targets for antiviral intervention:

  • Small Molecule Inhibitors: Compounds that disrupt the 10.4K-14.9K complex formation or interfere with their interaction with target receptors could potentially restore immune detection of infected cells.

  • Peptide-Based Inhibitors: Peptides mimicking interaction interfaces between the viral proteins or between the complex and its cellular targets could competitively inhibit function.

  • Gene-Based Approaches: Antisense oligonucleotides or siRNAs targeting E3B transcripts could selectively reduce expression of these immune evasion proteins.

  • Attenuated Vaccine Development: Understanding the contribution of E3B proteins to virulence could inform the development of attenuated vaccine strains with modifications in these genes.

  • Host-Directed Therapeutics: Identifying and targeting host factors required for E3B protein function could provide alternative antiviral strategies.

Research has shown that HAdV-B7, particularly genome type d (HAdV-B7d), is associated with severe respiratory infections requiring hospitalization, ICU admission, and mechanical ventilation . This clinical significance underscores the potential value of targeted interventions against virulence factors like the E3B proteins.

What insights can comparative analysis of E3B 14.9 kDa protein across different HAdV-B7 genome types provide about evolutionary adaptation and virulence?

Comparative analysis of E3B 14.9 kDa protein across different HAdV-B7 genome types offers valuable insights into viral evolution and pathogenesis:

Recent molecular typing has identified HAdV-B7 genome type d (HAdV-B7d) in clinical isolates associated with severe respiratory infections. This strain was previously identified only among strains circulating in Asia but appears to be reemerging globally . Patients infected with HAdV-B7 were significantly more likely than those with other adenovirus types to be adults and to have longer hospital stays .

Comparative genomic analysis could reveal:

  • Sequence variations in E3B genes that correlate with clinical severity

  • Evidence of selective pressure on immune evasion functions

  • Acquisition of novel functions through recombination or mutation

  • Adaptation to different host populations or tissue environments

Research approaches should include:

  • Sequencing E3B regions from diverse clinical isolates across different time periods and geographical regions

  • Functional characterization of variant E3B 14.9 kDa proteins from different genome types

  • Phylogenetic analysis to trace the evolutionary history of these proteins

  • In vitro and in vivo comparison of virulence between strains with different E3B variants

Understanding the evolution of these immune evasion mechanisms could provide predictive insights about emerging adenovirus strains with enhanced virulence potential.

What potential applications exist for engineered forms of the E3B 14.9 kDa protein in biotechnology and therapeutic development?

The unique properties of the E3B 14.9 kDa protein, particularly its ability to selectively target and down-regulate specific cell surface receptors, suggest several potential biotechnological and therapeutic applications:

  • Targeted Protein Degradation: The mechanism by which the 10.4K-14.9K complex induces receptor internalization and degradation could be adapted to create novel protein degradation technologies. Chimeric proteins incorporating receptor-binding domains with the trafficking functions of these viral proteins could selectively eliminate disease-associated surface proteins.

  • Immunomodulatory Therapeutics: Engineered versions could be developed to selectively down-regulate specific immune receptors involved in autoimmune diseases or transplant rejection.

  • Cancer Therapeutics: Modified versions targeting overexpressed receptors on cancer cells could potentially induce their degradation, complementing current antibody-based approaches.

  • Research Tools: Engineered variants could serve as tools for studying receptor trafficking and degradation pathways.

  • Vaccine Vector Development: Understanding E3B protein function informs the development of adenovirus vectors with modified immune evasion capabilities for vaccine applications.

Research has demonstrated that the 10.4K-14.9K complex functions in multiple cell types and is not cell type or tissue specific , suggesting broad potential utility across different cellular contexts. The selective nature of receptor targeting by these proteins provides a foundation for engineering specificity toward novel targets.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.