Recombinant Human adenovirus C serotype 2 Early E3B 14.5 kDa protein

Shipped with Ice Packs
In Stock

Description

Biological Functions and Mechanisms

The E3B 14.5 kDa protein operates in conjunction with the E3/10.4K protein as part of the receptor internalization and degradation (RID) complex to modulate host immune responses . Key roles include:

Immune Evasion Pathways

  • Fas (CD95) Downregulation: The RID complex binds Fas receptors, inducing their internalization and lysosomal degradation, thereby protecting infected cells from Fas-mediated apoptosis .

  • EGFR Inhibition: The complex also downregulates epidermal growth factor receptor (EGFR) surface expression, suppressing pro-inflammatory signaling .

  • TNF-α Resistance: Works synergistically with E3/14.7K to block tumor necrosis factor-alpha (TNF-α)-induced cell death and NF-κB-dependent inflammatory responses .

Functional Domains

  • LL Motif (10.4K): Targets the complex to endosomal compartments.

  • YxxΦ Motif (14.5K): Mediates lysosomal sorting .

Key Studies

  1. Fas Receptor Modulation

    • Transfection experiments showed that cells expressing E3/10.4K–14.5K exhibit a >80% reduction in Fas surface expression .

    • Lysosomotropic agents (e.g., chloroquine) blocked Fas degradation, confirming lysosomal targeting .

  2. Viral Pathogenesis

    • In HAdV-2-infected human lung (A549) and cervical (HeLa) cells, Fas downregulation correlated with resistance to apoptosis, enhancing viral persistence .

    • Mutant viruses lacking functional 10.4K or 14.5K genes failed to suppress Fas or EGFR, underscoring their interdependence .

  3. Structural Conservation

    • The E3B region is highly conserved in HAdV-C but varies in other species (e.g., HAdV-D lacks homologs) .

Recombinant Expression

  • Host System: E. coli .

  • Purification: Affinity chromatography via His tag .

  • Applications:

    • Mechanistic studies of viral immune evasion.

    • Development of anti-inflammatory therapeutics targeting Fas/EGFR pathways.

Stability Considerations

  • Reconstitution: Requires sterile water (0.1–1.0 mg/mL) with glycerol (5–50%) for long-term storage .

  • Avoid: Repeated freeze-thaw cycles .

Pathway Involvement

PathwayRole of E3B 14.5 kDa ProteinRelated Proteins
Apoptosis RegulationInhibits Fas-mediated cell deathFas, Caspase-8, TNF-α
EGFR SignalingSuppresses pro-inflammatory signalingEGFR, ERK, NF-κB
Lysosomal TraffickingMediates receptor degradationRID complex (10.4K–14.5K), LAMP1

Implications and Future Directions

The E3B 14.5 kDa protein is a pivotal tool for studying adenovirus pathogenesis and host-pathogen interactions. Its ability to disrupt apoptotic and inflammatory pathways highlights its potential as a target for antiviral therapies or immune-modulating agents. Ongoing research focuses on:

  • Structural mapping of receptor-binding interfaces.

  • Engineering attenuated viruses for vaccine development .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Early 3 receptor internalization and degradation beta protein; E3 RID-beta protein; Early E3B 14.5 kDa protein; E3-14.5k
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-130
Protein Length
Full Length of Mature Protein
Species
Human adenovirus C serotype 2 (HAdV-2) (Human adenovirus 2)
Target Protein Sequence
SQTSAPPKRHISCRFTQIWNIPSCYNKQSDLSEAWLYAIISVMVFCSTIFALAIYPYLDI GWNAIDAMNHPTFPVPAVIPLQQVIAPINQPRPPSPTPTEISYFNLTGGDD
Uniprot No.

Target Background

Function
This protein plays a crucial role in preventing infected cell apoptosis induced by the host immune system. It functions by down-regulating several cell surface receptors within the tumor necrosis factor (TNF) receptor superfamily, including FAS, TNFRSF10A/TRAIL receptor 1, and TNFRSF10B/TRAIL receptor 2. Down-regulation of these death receptors protects adenovirus-infected cells from apoptosis triggered by the death receptor ligands Fas ligand and TRAIL. The RID complex also down-regulates certain tyrosine kinase cell surface receptors, particularly the epidermal growth factor receptor (EGFR). RID-mediated Fas and EGFR down-regulation occurs through endocytosis of the receptors into endosomes, followed by transport to and degradation within lysosomes.
Protein Families
Adenoviridae E3_RID-beta family
Subcellular Location
Host membrane; Single-pass type I membrane protein.

Q&A

What is the Early E3B 14.5 kDa protein and where is it encoded in the adenovirus genome?

The E3B 14.5 kDa protein is one of the immunomodulatory proteins encoded in the early transcription unit 3 (E3) of adenovirus. Specifically, it is located in the E3B region, which is highly conserved among human adenoviruses . The E3 region encodes several proteins involved in immune evasion, including the E3/19K protein that interferes with antigen presentation and T cell recognition, and the E3B proteins (10.4K, 14.5K, and 14.7K) that can protect infected cells from cytokine-mediated lysis . The 14.5K protein functions primarily in conjunction with the 10.4K protein as a complex that modulates host immune responses during viral infection.

What are the primary functions of the E3B 14.5 kDa protein?

The E3B 14.5 kDa protein, in complex with the 10.4K protein, has several crucial immune evasion functions:

  • Down-regulation of the apoptosis receptor CD95 (Fas/APO-1) on the cell surface, which protects infected cells from Fas-mediated apoptosis .

  • Induction of Fas internalization and degradation in endosomal/lysosomal vesicles .

  • Protection of infected cells from immune surveillance and elimination.

  • Contribution to viral persistence in the host.

Research has demonstrated that the 14.5K protein requires the 10.4K protein for its function, as disruption of either gene restores Fas expression in cells . This coordinated activity is essential for the virus to evade immune detection and elimination.

How does the E3B 14.5 kDa protein interact with cellular proteins?

The E3B 14.5 kDa protein primarily interacts with the 10.4K protein to form a functional complex that targets cell surface receptors. This complex selectively recognizes and down-regulates specific cell surface proteins, particularly the Fas receptor CD95. Through this interaction, the 10.4K-14.5K complex induces the internalization of Fas from the cell surface and redirects it to endosomal/lysosomal compartments for degradation .

Experimental evidence indicates that this protein complex acts on Fas molecules at the cell surface rather than interfering with their transport through the secretory pathway. This is supported by observations that Fas disappears more rapidly from the cell surface upon adenovirus infection than it does upon Brefeldin A (BFA) treatment, which blocks export from the Golgi apparatus . This suggests that the 10.4K-14.5K complex actively removes existing Fas molecules from the plasma membrane rather than preventing newly synthesized Fas from reaching the surface.

What experimental methods are effective for studying E3B 14.5 kDa protein function?

Several experimental approaches have proven effective for investigating the function of the E3B 14.5 kDa protein:

  • Selective gene disruption: By mutating the ATG start codon and/or introducing a frameshift in the 14.5K ORF, researchers can selectively eliminate expression of this protein while minimizing alterations that might affect splicing of neighboring genes .

  • Stable transfection systems: Establishing cell lines that express the entire E3 region or modified versions with specific mutations allows for the study of individual E3 proteins .

  • Immunoprecipitation and Western blot analysis: These techniques are crucial for confirming expression or disruption of the 14.5K protein in experimental systems .

  • Flow cytometry: This method enables quantification of cell surface proteins like Fas, allowing researchers to measure the effects of 14.5K expression on receptor levels .

  • Lysosomotropic agents: Using compounds that inhibit lysosomal degradation can help visualize the fate of internalized Fas molecules and confirm the mechanism of 14.5K-mediated down-regulation .

How can mutations in the E3B 14.5 kDa protein affect its function?

Mutations in the E3B 14.5 kDa protein can profoundly impact its ability to down-regulate Fas and other cell surface receptors. Studies have shown that disruption of the 14.5K ORF leads to restoration of Fas expression on the cell surface, indicating that the protein's function is completely abolished . This demonstrates the essential role of 14.5K in the receptor down-regulation process.

When designing mutations for functional studies, researchers should be cautious about potential effects on splicing and expression of neighboring genes. Previous studies have demonstrated that deletions within the E3 region can profoundly affect splicing, thereby altering expression of multiple E3 proteins, including E3/19K . For this reason, minimal alterations such as point mutations or small insertions that disrupt the reading frame are preferred over larger deletions when studying specific E3B protein functions.

What is the mechanism by which E3B 14.5 kDa protein down-regulates Fas?

The 10.4K-14.5K complex down-regulates Fas through a multi-step process:

  • Recognition of Fas molecules on the cell surface

  • Induction of Fas internalization via endocytosis

  • Redirection of internalized Fas to the endosomal/lysosomal pathway

  • Degradation of Fas in lysosomes

This mechanism has been elucidated through experiments showing that in the presence of lysosomotropic agents, Fas accumulates in endosomal/lysosomal vesicles rather than being degraded . Additionally, the rapid disappearance of Fas from the cell surface upon infection, compared to the slower decay seen with BFA treatment, suggests that the 10.4K-14.5K complex acts primarily on cell surface Fas rather than newly synthesized molecules in the secretory pathway .

The functional significance of Fas down-regulation has been demonstrated by experiments showing that adenovirus infection protects cells from Fas-mediated apoptosis, an effect that is largely eliminated when using mutant viruses lacking E3 genes .

How can recombinant E3B 14.5 kDa protein be expressed and purified?

For expression and purification of recombinant E3B 14.5 kDa protein, researchers can employ several strategies:

Expression systems:

  • Bacterial expression - While cost-effective, the membrane-associated nature of 14.5K may create challenges for proper folding.

  • Mammalian expression - HEK293 or CHO cells can be transfected with expression vectors containing the 14.5K gene, allowing for proper post-translational modifications.

  • Baculovirus-insect cell system - Provides high yields of properly folded eukaryotic proteins.

Purification approaches:

  • Affinity chromatography using epitope tags (His, FLAG, etc.) fused to the 14.5K protein

  • Immunoaffinity purification using antibodies against 14.5K

  • Size exclusion chromatography to separate the purified protein

When designing expression constructs, it's important to consider that the 14.5K protein functions in complex with 10.4K. For functional studies, co-expression of both proteins may be necessary to obtain the biologically active complex.

What detection methods are most effective for studying E3B 14.5 kDa protein?

Several detection methods have proven effective for studying the E3B 14.5 kDa protein:

  • Immunoprecipitation combined with Western blot analysis - This approach has been successfully used to detect both 10.4K and 14.5K proteins in transfected cells .

  • Flow cytometry - While not directly detecting the 14.5K protein, this method can measure its functional effect on Fas and other surface receptors .

  • Immunofluorescence microscopy - Can visualize the subcellular localization of 14.5K and co-localization with its target proteins.

  • Mass spectrometry - For detailed analysis of protein modifications and interactions.

The table below summarizes the advantages and limitations of each method:

Detection MethodAdvantagesLimitationsApplications
Western blotHigh specificity, quantifiableRequires cell lysisProtein expression levels
ImmunoprecipitationEnriches low-abundance proteinsAntibody-dependentProtein-protein interactions
Flow cytometryQuantitative, single-cell analysisIndirect functional detectionReceptor down-regulation
ImmunofluorescenceSpatial informationResolution limitsProtein localization
Mass spectrometryPrecise identification, modificationsComplex sample preparationProtein characterization

How can the functional effects of E3B 14.5 kDa protein be measured?

The functional effects of the E3B 14.5 kDa protein can be measured through several experimental approaches:

  • Fas surface expression assay - Flow cytometry can quantify changes in cell surface Fas levels in the presence or absence of 14.5K expression .

  • Apoptosis assays - Measuring the protection from Fas-mediated apoptosis provides a functional readout of 14.5K activity. The MTT assay has been used successfully to demonstrate that adenovirus infection protects cells from Fas-induced cell death .

  • Receptor internalization assays - These can track the fate of cell surface Fas following expression of 14.5K, using fluorescently labeled antibodies or Fas constructs.

  • Lysosomal inhibition studies - Treatment with lysosomotropic agents can reveal the accumulation of internalized Fas in endosomal/lysosomal compartments, confirming the mechanism of 14.5K-mediated down-regulation .

In the published research, cells expressing 14.5K showed almost complete protection from Fas-mediated apoptosis, while cells infected with mutant viruses lacking E3 genes remained susceptible to Fas-induced cell death . This provides a clear functional readout of 14.5K activity that can be quantified using cell viability assays.

How can knowledge of E3B 14.5 kDa protein function inform oncolytic adenovirus design?

Understanding the function of the E3B 14.5 kDa protein can significantly impact the design of oncolytic adenoviruses for cancer therapy:

  • Immune evasion modulation - Since 14.5K helps the virus evade immune responses by down-regulating Fas, selective modification of this protein could tune the immunogenicity of oncolytic adenoviruses .

  • Enhancing oncolytic potential - By manipulating 14.5K function, researchers might create viruses that selectively replicate in and kill cancer cells while sparing normal cells .

  • Targeting specific tumor types - Knowledge of how 14.5K interacts with cellular proteins could inform the development of conditionally replicating adenoviruses (CRAs) tailored to specific cancer characteristics .

Conditionally replicating adenoviruses represent a promising approach for cancer therapy, with strategies involving deletion of specific portions of viral genes to achieve selective replication in cancer cells . The E3 region proteins, including 14.5K, play important roles in modulating the host immune response and could be leveraged to enhance therapeutic efficacy.

What role does E3B 14.5 kDa protein play in adenoviral vector development?

The E3B 14.5 kDa protein's role in immune evasion has important implications for adenoviral vector development:

  • Vector immunogenicity - Since E3B proteins like 14.5K modulate immune responses, their presence or absence in adenoviral vectors can significantly impact the immunogenicity of these vectors .

  • Vector persistence - By protecting infected cells from immune elimination, 14.5K could potentially enhance the duration of transgene expression from adenoviral vectors .

  • Safety considerations - Understanding 14.5K's effects on host cell survival may inform safety assessments of adenoviral vectors for gene therapy and vaccination .

How can the E3B 14.5 kDa protein's immune evasion mechanisms be leveraged in research?

The immune evasion mechanisms of the E3B 14.5 kDa protein offer several research applications:

  • Apoptosis pathway studies - The specific targeting of Fas by 10.4K-14.5K provides tools for studying Fas-mediated apoptosis pathways .

  • Receptor trafficking research - The mechanism by which 10.4K-14.5K induces Fas internalization and degradation offers insights into receptor trafficking and turnover .

  • Immune modulation strategies - Understanding how 14.5K evades immune responses could inform broader immune modulation approaches for therapeutic applications .

  • Viral pathogenesis models - The role of Fas in anti-adenoviral immunity, revealed through studies of 14.5K function, contributes to our understanding of viral pathogenesis .

Research has demonstrated that adenovirus-infected cells are protected from Fas-mediated apoptosis due to the activity of E3 proteins, particularly the 10.4K-14.5K complex . This specific immune evasion mechanism provides valuable insights into both viral strategies and host defense systems.

What are the emerging areas of study for E3B 14.5 kDa protein?

Several emerging research areas hold promise for advancing our understanding of the E3B 14.5 kDa protein:

  • Structural biology - Determining the three-dimensional structure of the 10.4K-14.5K complex would provide insights into its mechanism of action and potential for therapeutic targeting.

  • Systems biology approaches - Comprehensive analysis of host protein interactions and cellular pathway perturbations induced by 14.5K expression.

  • In vivo significance - Further exploration of the role of 14.5K in viral pathogenesis using animal models and transgenic approaches .

  • Receptor specificity determinants - Identifying the molecular features that determine which cell surface receptors are targeted by the 10.4K-14.5K complex.

  • Therapeutic applications - Exploring how 14.5K's immune evasion properties could be harnessed for oncolytic viral therapy or gene delivery .

What methodological advances are needed for better studying E3B 14.5 kDa protein?

Advancing research on the E3B 14.5 kDa protein would benefit from several methodological improvements:

  • Better antibodies and detection reagents - Development of high-affinity, specific antibodies for improved detection and localization studies.

  • Real-time imaging approaches - Technologies for visualizing the dynamics of 14.5K-mediated receptor down-regulation in living cells.

  • High-throughput screening methods - Systems for identifying small molecules that modulate 14.5K function or mimic its effects.

  • Improved animal models - Development of transgenic or humanized models that better recapitulate human adenovirus infections and immune responses.

  • Cryo-EM and advanced structural techniques - Methods to determine the structure of the 10.4K-14.5K complex in its native membrane environment.

What potential therapeutic applications might emerge from E3B 14.5 kDa protein research?

Research on the E3B 14.5 kDa protein could lead to several therapeutic applications:

  • Enhanced oncolytic adenoviruses - Leveraging 14.5K's immune evasion properties to create more effective cancer-killing viruses .

  • Novel immune modulators - Developing peptides or small molecules that mimic 14.5K's ability to down-regulate specific immune receptors.

  • Improved adenoviral vectors - Creating vectors with modified E3B regions for optimized gene delivery in different therapeutic contexts .

  • Anti-inflammatory applications - Utilizing 14.5K-derived strategies to modulate excessive inflammatory or autoimmune responses involving Fas signaling.

The first approved oncolytic virus medicine, Oncorine (H101), was based on adenovirus technology and approved in China in 2005 for head and neck cancer treatment . Further understanding of E3B proteins like 14.5K could lead to next-generation oncolytic adenoviruses with enhanced efficacy and safety profiles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.