Recombinant Human adenovirus C serotype 5 Early E3B 14.6 kDa protein

Shipped with Ice Packs
In Stock

Description

Functional Role in Viral Pathogenesis

The E3B 14.6 kDa protein contributes to immune evasion by:

  • Inhibiting apoptosis: Interferes with host cell death pathways to prolong viral replication .

  • Suppressing interferon response: Blocks antiviral signaling to evade immune detection .

  • Modulating host interactions: Binds host proteins involved in immune regulation, such as those in the NF-κB pathway .

These functions are critical for adenovirus survival in human respiratory and gastrointestinal tissues, where HAdV-C infections are prevalent .

Research Applications

This recombinant protein is widely used in:

ApplicationStudy Focus
Immune evasion mechanismsCharacterizing interactions with host immune proteins (e.g., interferon regulators) .
Viral vector developmentEngineering adenoviral vectors with modified E3B regions for gene therapy .
Diagnostic toolsServing as an antigen in serological assays for HAdV-C detection .
Structural biologyAnalyzing protein conformation and binding sites via X-ray crystallography .

Recent Research Findings

  • Genomic recombination: Studies identified chimeric HAdV-C strains (e.g., BR-211) with E3B regions recombined between serotypes 1 and 89, highlighting evolutionary adaptability .

  • Therapeutic targeting: The protein’s role in immune suppression has made it a candidate for antiviral drug design .

  • Host-pathogen interactions: Structural analyses reveal conserved domains critical for binding host TRAIL receptors, influencing apoptosis pathways .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
Early E3B 14.6 kDa protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-132
Protein Length
Full Length of Mature Protein
Species
Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)
Target Protein Sequence
SPTSKPQRHISCRFTRIWNIPSCYNEKSDLSEAWLYAIISVMVFCSTILALAIYPYLDIG WKRIDAMNHPTFPAPAMLPLQQVVAGGFVPANQPRPTSPTPTEISYFNLTGGDD
Uniprot No.

Target Background

Function
Down-regulates the epidermal growth factor receptor (EGFR) and inhibits tumor necrosis factor (TNF)-mediated cytolysis.
Protein Families
Adenoviridae E3_14 family
Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

What is the Human adenovirus C serotype 5 Early E3B 14.6 kDa protein?

The Human adenovirus C serotype 5 Early E3B 14.6 kDa protein (often referred to as the 14.5K protein in scientific literature) is one of three proteins encoded by the E3B region of the adenovirus genome. The E3B region is highly conserved among human adenoviruses and codes for three proteins: 10.4K, 14.5K, and 14.7K. The 14.5K protein functions primarily in conjunction with the 10.4K protein to form a complex that modulates host immune responses. This protein complex plays a critical role in the virus's ability to evade host immune defenses by down-regulating cell surface receptors involved in apoptosis and immune recognition .

The E3B 14.6 kDa protein contains specific sequence motifs in its cytoplasmic tail, particularly the YxxΦ sorting motif, which is involved in targeting proteins to endosomal/lysosomal compartments. This structural feature is essential for its function in inducing internalization and subsequent degradation of cell surface receptors . The protein is expressed during the early phase of viral infection, prior to DNA replication, which allows the virus to establish conditions favorable for viral replication before the host immune system can effectively respond.

How does the E3B 14.6 kDa protein relate to other E3 proteins in the adenovirus genome?

The E3B 14.6 kDa protein is part of a larger E3 transcription unit that is the most divergent coding region among human adenoviruses. This unit exhibits the highest nucleotide diversity across different adenovirus types . In Human adenovirus C serotype 2 (HAdV-C2), a closely related virus to HAdV-C5, the E3 region produces seven proteins in total .

The E3 region is divided into E3A and E3B segments, which are regulated transcriptionally by poly(A) site selection. Both E3A and E3B pre-mRNAs undergo extensive splicing during processing to yield multiple protein products . While the 5' end of E3 encodes a 12.5K protein of unknown function in most adenovirus species, the 3' end contains three conserved coding regions that are present in all adenovirus types: receptor internalization and degradation α (RID-α), RID-β, and 14.7K . These conserved proteins play critical roles in immune evasion mechanisms.

Table 1: E3 Proteins of Human Adenovirus C and Their Functions

ProteinApproximate SizePrimary Function
E3/12.5K12.5 kDaUnknown function
E3/19K19 kDaInterferes with antigen presentation and T cell recognition
E3/10.4K (RID-α)10.4 kDaForms complex with 14.5K to down-regulate Fas and EGFR
E3/14.5K (RID-β)14.5 kDaForms complex with 10.4K to down-regulate Fas and EGFR
E3/14.7K14.7 kDaProtects cells from TNF-α mediated lysis
E3/11.6K11.6 kDaInvolved in cell lysis and viral release

What are effective methods for selectively inactivating E3B 14.6 kDa protein expression for functional studies?

A methodical approach involves:

  • Mutating the ATG start codon to prevent translation initiation

  • Introducing a frameshift mutation early in the coding sequence

  • Incorporating these mutations into a complete E3 region plasmid

  • Transfecting the mutated plasmid into appropriate cell lines (such as 293 cells)

  • Establishing permanent cell clones expressing the mutated E3 region

  • Confirming selective disruption through immunoprecipitation and Western blot analysis

These methods have been successfully used to generate cell lines with selective disruption of the 14.5K protein while maintaining normal expression levels of other E3 proteins, including E3/19K and E3/14.7K . This selective inactivation approach offers significant advantages over deletion-based methods, as it minimizes unintended effects on neighboring gene expression.

How can researchers verify successful inactivation of the E3B 14.6 kDa protein?

Verification of successful inactivation requires a combination of techniques to ensure that only the target protein's expression is affected while neighboring genes remain intact. A comprehensive verification protocol includes:

In previous studies, researchers have used a combination of immunoprecipitation and Western blot analysis to confirm selective elimination of the 14.5K protein. The absence of the target protein band (approximately 14.5 kDa) in the Western blot, coupled with normal expression of other E3 proteins (10.4K, 14.7K, and 19K), provides strong evidence of successful selective inactivation .

It is critical to include appropriate controls in these verification steps, such as cell lines expressing the wild-type E3 region and cell lines with mutations in other E3B genes, to establish the specificity of the inactivation.

What experimental design approaches are most effective for studying the function of E3B 14.6 kDa protein?

An effective experimental design for studying the function of the E3B 14.6 kDa protein requires careful planning and control of variables. Based on established research protocols, the following approaches have proven most effective:

  • Comparative analysis using selective gene disruption:

    • Generate cell lines with selective disruption of individual E3B genes (10.4K, 14.5K, and 14.7K)

    • Express these constructs in the same cellular background (e.g., 293 cells)

    • Compare phenotypes across multiple clones expressing similar levels of other E3 proteins

  • Functional assays to assess specific activities:

    • Measure cell surface levels of relevant receptors (e.g., Fas, EGFR) using flow cytometry

    • Assess sensitivity to receptor-mediated apoptosis using appropriate ligands (e.g., anti-Fas antibodies)

    • Compare results between wild-type E3-expressing cells and cells with selectively inactivated E3B proteins

  • Mechanistic studies to determine mode of action:

    • Use lysosomotropic agents to block endosomal/lysosomal degradation

    • Perform immunofluorescence microscopy to track receptor internalization

    • Measure total protein levels versus surface expression to distinguish between degradation and internalization effects

  • Control for expression levels:

    • Select cell clones expressing similar amounts of E3 proteins as judged by FACS analysis

    • Confirm expression levels through immunoprecipitation and Western blot analysis

    • Use at least 3-4 independent clones for each condition to account for clonal variation

This systematic approach allows researchers to distinguish the specific functions of the E3B 14.6 kDa protein from those of other E3B proteins and to determine its mechanism of action with high confidence .

How does the E3B 14.6 kDa protein contribute to immune evasion in adenovirus infection?

The E3B 14.6 kDa protein plays a central role in adenovirus immune evasion by forming a functional complex with the 10.4K protein that efficiently down-regulates cell surface expression of the apoptosis receptor CD95 (Fas, APO-1). This down-regulation protects infected cells from Fas-mediated apoptosis, which is a key mechanism used by the host immune system to eliminate virus-infected cells .

The 10.4K-14.5K complex specifically targets Fas on the cell surface, inducing its internalization and subsequent degradation in endosomes or lysosomes. This selective removal of Fas from the cell surface renders infected cells resistant to Fas ligand-induced apoptosis, effectively blocking this arm of the immune response . The effect is observed in multiple cell types, including:

  • Human lung epithelial cells (A549)

  • Human cervix carcinoma cells (HeLa)

  • Breast carcinoma cells (MCF-Fas)

  • Normal human diploid foreskin and lung fibroblasts (SeBu, MRC-5)

This widespread effectiveness across diverse cell types indicates that the function of the E3B 14.6 kDa protein is neither cell type nor tissue-specific, nor does it require immortalization. Consequently, this mechanism is likely highly relevant for the virus life cycle in vivo and contributes significantly to viral persistence and pathogenesis .

What is the molecular mechanism by which the 10.4K-14.5K complex down-regulates Fas?

The molecular mechanism of Fas down-regulation by the 10.4K-14.5K complex involves a sequence of events that lead to the internalization and degradation of the Fas receptor. Based on detailed experimental evidence, the process includes:

  • Formation of a functional complex between the 10.4K and 14.5K proteins

  • Binding of this complex to Fas on the cell surface

  • Induction of Fas internalization into endosomes/lysosomes

  • Degradation of Fas within these compartments

This mechanism is supported by the observation that in the presence of lysosomotropic agents, which inhibit lysosomal degradation, Fas accumulates in endosomal/lysosomal vesicles rather than being completely degraded . The process results in a profound reduction of both cell surface and total Fas levels in cells expressing both 10.4K and 14.5K proteins.

The structural features of both proteins support this mechanism. The 10.4K protein contains LL motifs and the 14.5K protein contains YxxΦ sorting motifs in their cytoplasmic tails. Both of these sequence motifs have been implicated in targeting proteins to endosomal/lysosomal compartments . These structural elements are likely essential for the complex's ability to induce receptor internalization and subsequent degradation.

Table 2: Key Structural Features of 10.4K and 14.5K Proteins Involved in Receptor Internalization

ProteinStructural MotifLocationFunction
10.4KLL motifCytoplasmic tailTargeting to endosomal/lysosomal compartments
14.5KYxxΦ sorting motifCytoplasmic tailTargeting to endosomal/lysosomal compartments

Is the down-regulation of cell surface receptors by the E3B 14.6 kDa protein specific to Fas, or does it affect other receptors?

This selectivity suggests that the 10.4K-14.5K complex recognizes specific structural or sequence features present in certain cell surface receptors, rather than indiscriminately targeting all receptors or even all members of the TNFR family. The precise molecular determinants that confer susceptibility to down-regulation by the 10.4K-14.5K complex remain an area of active investigation.

How can researchers effectively design experiments to study the interaction between the 10.4K-14.5K complex and its target receptors?

Designing effective experiments to study the interaction between the 10.4K-14.5K complex and its target receptors requires a multi-faceted approach that combines molecular, cellular, and biochemical techniques. Based on successful research strategies, the following experimental design considerations are recommended:

  • Co-immunoprecipitation studies:

    • Use specific antibodies against 10.4K or 14.5K to precipitate the protein complex

    • Analyze the co-precipitation of partner proteins and potential receptor targets

    • Include appropriate controls (e.g., lysates from cells expressing mutated forms of 10.4K or 14.5K)

  • Surface plasmon resonance or other binding assays:

    • Express and purify recombinant 10.4K and 14.5K proteins

    • Immobilize purified Fas or other potential target receptors

    • Measure binding kinetics and affinity between the complex and receptors

    • Compare binding parameters under different conditions (pH, salt concentration) to identify critical factors

  • Confocal microscopy for co-localization studies:

    • Generate fluorescently tagged versions of 10.4K, 14.5K, and target receptors

    • Track their localization in live cells over time

    • Use time-lapse imaging to observe receptor internalization dynamics

    • Include endosomal/lysosomal markers to confirm the trafficking pathway

  • Mutational analysis of interaction domains:

    • Create point mutations or domain swaps in the cytoplasmic tails of 10.4K and 14.5K

    • Focus on the LL motifs in 10.4K and YxxΦ sorting motifs in 14.5K

    • Assess the effect of these mutations on complex formation and receptor down-regulation

    • Map the minimal regions required for functional interaction

These experimental approaches should be combined with appropriate controls and quantitative analysis to provide a comprehensive understanding of the molecular interactions involved in receptor down-regulation by the 10.4K-14.5K complex.

What cell culture systems are most appropriate for studying E3B 14.6 kDa protein function?

The selection of appropriate cell culture systems is critical for studying E3B 14.6 kDa protein function. Based on published research, several cell types have been successfully used, each offering specific advantages:

  • Human embryonic kidney (HEK) 293 cells:

    • Readily transfectable with high efficiency

    • Support stable expression of E3 proteins

    • Allow generation of permanent cell lines expressing wild-type or mutated E3 proteins

    • Widely used for initial characterization of E3 protein functions

  • Human epithelial cell lines (A549, HeLa):

    • Represent natural targets for adenovirus infection

    • Express physiologically relevant levels of target receptors (Fas, EGFR)

    • Allow for both transfection and infection studies

    • Demonstrated to respond to E3B proteins with receptor down-regulation

  • Primary human cells (fibroblasts):

    • Provide a non-transformed cellular environment

    • More closely mimic in vivo conditions

    • Confirm that E3B protein functions are not artifacts of immortalization

    • Examples include SeBu (foreskin fibroblasts) and MRC-5 (lung fibroblasts)

  • Specialized reporter cell lines:

    • MCF-Fas cells with high Fas expression for apoptosis studies

    • Cell lines with fluorescently tagged receptors for trafficking studies

    • Systems with inducible expression of E3 proteins for temporal control

The choice of cell system should be guided by the specific research question. For mechanistic studies of receptor trafficking, epithelial cell lines with well-characterized endocytic pathways are preferred. For functional studies of apoptosis protection, cells that are sensitive to Fas-mediated apoptosis provide the most informative results. When possible, key findings should be validated across multiple cell types to ensure their physiological relevance.

Table 3: Comparison of Cell Culture Systems for Studying E3B 14.6 kDa Protein Function

Cell SystemAdvantagesLimitationsRecommended Applications
HEK 293 cellsHigh transfection efficiency; Stable expressionTransformed cells; May have atypical receptor expressionInitial characterization; Protein-protein interactions
A549/HeLa cellsNatural adenovirus targets; Epithelial phenotypeCancer-derived; May have altered signalingReceptor trafficking; Infection studies
Primary fibroblastsNon-transformed; Physiological receptor levelsLimited lifespan; Lower transfection efficiencyValidation of key findings; Physiological relevance
Specialized reporter linesOptimized for specific readoutsMay contain artificial constructsFocused mechanistic studies; High-throughput screening

What are the most reliable methods for detecting and measuring Fas down-regulation by the E3B 14.6 kDa protein?

Reliable detection and measurement of Fas down-regulation by the E3B 14.6 kDa protein require a combination of complementary techniques that assess both surface expression and total protein levels. Based on established protocols, the following methods are recommended:

  • Flow cytometry for cell surface expression:

    • Use fluorescently labeled anti-Fas antibodies that recognize extracellular domains

    • Include isotype control antibodies to establish background staining

    • Perform live cell staining at 4°C to prevent receptor internalization during antibody incubation

    • Quantify mean fluorescence intensity (MFI) as a measure of surface expression

    • Include positive controls (untransfected cells) and negative controls (cells lacking Fas)

  • Western blot analysis for total protein levels:

    • Prepare total cell lysates using appropriate lysis buffers

    • Separate proteins by SDS-PAGE and transfer to membranes

    • Probe with specific anti-Fas antibodies that recognize intracellular domains

    • Include loading controls (β-actin, GAPDH) for normalization

    • Perform densitometric analysis for quantification

  • Immunofluorescence microscopy for receptor localization:

    • Fix and permeabilize cells to access intracellular compartments

    • Use antibodies against Fas and markers for different cellular compartments

    • Include co-staining for 10.4K and 14.5K to assess co-localization

    • Use confocal microscopy for high-resolution imaging of receptor trafficking

  • Pulse-chase experiments for receptor turnover:

    • Metabolically label cells with radioactive amino acids

    • Chase with unlabeled medium for various time periods

    • Immunoprecipitate Fas and analyze by SDS-PAGE and autoradiography

    • Calculate half-life of Fas in the presence or absence of 10.4K-14.5K

  • Inhibitor studies to dissect the mechanism:

    • Treat cells with lysosomotropic agents (e.g., chloroquine, NH4Cl)

    • Use proteasome inhibitors (e.g., MG132) as controls

    • Monitor accumulation of Fas in specific compartments

    • Distinguish between degradation and redistribution mechanisms

These methods, when used in combination, provide a comprehensive assessment of Fas down-regulation and insight into the underlying mechanisms. Quantitative analysis should include statistical comparisons between wild-type and mutant conditions to establish the significance of observed differences .

How does the E3B 14.6 kDa protein contribute to adenovirus pathogenesis in vivo?

  • Protection from immune-mediated clearance:
    The ability of the 10.4K-14.5K complex to down-regulate Fas likely protects infected cells from elimination by Fas ligand-expressing immune cells, particularly cytotoxic T lymphocytes and natural killer cells. This protection would allow infected cells to survive longer and produce more viral progeny, contributing to viral persistence .

  • Modulation of inflammatory responses:
    By targeting specific cell surface receptors involved in immune signaling, the E3B proteins may alter the inflammatory environment at sites of infection, potentially limiting the recruitment and activation of immune cells that could clear the infection.

  • Effects on viral spread and tissue tropism:
    E3B proteins may influence which cell types support persistent infection by modulating their susceptibility to immune-mediated clearance. Cells with high expression of Fas might be particularly dependent on E3B function for supporting productive infection.

  • Contribution to viral release mechanisms:
    The E3 region contains proteins involved in cell lysis and viral release. Mutations in the E3a-11.6K protein have been shown to result in smaller plaque formation, indicating reduced viral spread . The E3B 14.6 kDa protein may work in concert with these lytic functions to optimize viral propagation.

Animal models for adenovirus-induced disease and transgenic mice expressing E3 proteins have provided support for the importance of E3 proteins in modulating immune responses in vivo . Future research using humanized mouse models or organoid culture systems may provide more direct evidence for the role of the E3B 14.6 kDa protein in human disease.

What structural elements of the E3B 14.6 kDa protein are critical for its function?

The functional activity of the E3B 14.6 kDa protein depends on specific structural elements that enable its interaction with partner proteins and target receptors. Current research has identified several critical features:

  • YxxΦ sorting motif in the cytoplasmic tail:
    This conserved motif, where Y is tyrosine, x is any amino acid, and Φ is a hydrophobic residue, plays a crucial role in targeting proteins to endosomal/lysosomal compartments. Mutation of this motif would likely impair the ability of the 14.5K protein to direct receptor internalization and degradation .

  • Interaction domains for 10.4K binding:
    The 14.5K protein forms a functional complex with 10.4K, and this interaction appears to be essential for their cell surface expression and function. The specific domains mediating this interaction remain to be fully characterized but are likely critical for function.

  • Transmembrane domain:
    As a membrane protein, the transmembrane domain of 14.5K is presumably important for its correct localization and orientation in the cell membrane, which would be necessary for interaction with membrane-bound receptors like Fas.

  • Potential receptor recognition domains:
    Regions of the 14.5K protein that interact directly with target receptors (Fas, EGFR) would be essential for the selective down-regulation of these proteins. These domains remain to be definitively identified.

  • Post-translational modifications:
    Potential phosphorylation of the tyrosine residue in the YxxΦ motif or other modifications might regulate the activity or trafficking of the 14.5K protein.

Detailed structural studies, including crystallography or cryo-electron microscopy of the 10.4K-14.5K complex, would provide valuable insights into the three-dimensional arrangement of these proteins and their interaction with target receptors. Combined with site-directed mutagenesis and functional assays, such structural information would significantly advance our understanding of the molecular mechanisms underlying receptor down-regulation.

How have E3B proteins evolved across different adenovirus species, and what does this reveal about their function?

The evolution of E3B proteins across different adenovirus species provides important insights into their functional significance and adaptation to host immune pressures. Key evolutionary patterns include:

  • Conservation of core E3B proteins:
    All adenovirus species contain conserved coding regions near the 3' end of E3, including receptor internalization and degradation α (RID-α), RID-β, and 14.7K . This conservation suggests essential functions for these proteins in the viral life cycle.

  • High sequence diversity:
    Despite the conservation of E3B genes, the E3 transcription unit as a whole exhibits the highest nucleotide diversity among adenoviruses . This diversity likely reflects adaptation to different host immune environments and potentially different receptor targets across host species and tissues.

  • Adaptive evolution under immune pressure:
    The pattern of sequence variation in E3B proteins is consistent with evolution under selective pressure from host immune responses. Regions interacting directly with host factors would be expected to show particularly rapid evolution to counter evolving host defenses.

  • Functional conservation despite sequence divergence:
    Despite sequence differences, the function of down-regulating immune receptors appears to be conserved across diverse adenovirus types, suggesting convergent evolution toward similar immune evasion strategies.

Comparative genomic analysis of E3B proteins from different adenovirus species, combined with functional studies of their activities, would provide a more comprehensive understanding of how these proteins have evolved to counter host immune responses. Such studies could also identify conserved structural elements that might serve as targets for broad-spectrum antiviral interventions.

What are the key unresolved questions about the E3B 14.6 kDa protein that warrant further investigation?

Despite significant advances in our understanding of the E3B 14.6 kDa protein, several important questions remain unresolved and represent promising avenues for future research:

  • Structural basis of receptor recognition:
    How does the 10.4K-14.5K complex recognize specific cell surface receptors like Fas and EGFR while sparing others like CD40? Detailed structural studies of the complex and its interaction with target receptors would provide valuable insights into this selectivity.

  • Complete receptor repertoire:
    Beyond Fas and EGFR, what other cell surface receptors are targeted by the 10.4K-14.5K complex? A comprehensive proteomics approach comparing surface proteins in the presence and absence of these viral proteins would help identify the full range of targets.

  • Mechanistic details of receptor internalization:
    What cellular machinery is recruited by the 10.4K-14.5K complex to facilitate receptor internalization? Identification of host interacting partners would clarify how these viral proteins hijack cellular trafficking pathways.

  • Role in diverse tissue environments:
    How does the function of the E3B 14.6 kDa protein vary across different tissues that adenovirus can infect? Its activity might be particularly important in specific microenvironments with high immune pressure.

  • Therapeutic potential:
    Could inhibition of the E3B 14.6 kDa protein enhance immune clearance of adenovirus-infected cells? Conversely, could this protein or derived peptides be used therapeutically to modulate excessive Fas-mediated apoptosis in inflammatory conditions?

Addressing these questions will require interdisciplinary approaches combining structural biology, cell biology, immunology, and virology. The answers will not only advance our understanding of adenovirus pathogenesis but may also provide insights into fundamental cellular processes of receptor trafficking and immune regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.