Recombinant Human adenovirus C serotype 6 Early E3A 11.6 kDa glycoprotein

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Adenovirus C Serotype 6 Early E3A kDa Glycoprotein

The Recombinant Human Adenovirus C Serotype 6 Early E3A 11.6 kDa Glycoprotein is a genetically engineered protein derived from the early E3A gene of Human Adenovirus C Serotype 6 (HAdV-6). This glycoprotein is critical for understanding viral immune evasion mechanisms and has applications in virology, vaccine development, and gene therapy. Below is a detailed analysis of its molecular characteristics, biological functions, and research implications.

Biological Functions and Pathways

The E3A 11.6 kDa glycoprotein is part of the adenoviral E3 region, which encodes proteins that modulate host immune responses. Key functions include:

FunctionMechanismRelevance
Immune EvasionInteracts with host immune components to suppress antiviral responses .Enables viral persistence by evading host defenses.
Viral ReplicationMay assist in viral genome replication or capsid assembly .Contributes to efficient viral propagation.
Recombination EventsInvolved in homologous recombination with other adenoviruses (e.g., HAdV-1, HAdV-2) .Drives genetic diversity in adenoviral populations.

Pathways:

  • Host-Pathogen Interaction: Modulates cytokine production and immune cell activation.

  • Viral Genome Stability: Maintains capsid integrity through interactions with structural proteins .

Gene Therapy and Vector Development

HAdV-6 vectors lacking E3 expression (e.g., HD-Ad6) show enhanced liver tropism compared to other species C adenoviruses (HAdV-1, HAdV-2, HAdV-5) . This suggests the E3 glycoprotein may influence tissue specificity or immune clearance.

Key Observations:

  • Liver Transduction: HD-Ad6 exhibits 2–100× greater luciferase activity in the liver than other species C vectors .

  • Immune Evasion: E3-deleted vectors avoid host immune recognition, enabling prolonged gene expression .

Viral Evolution and Recombination

Recombination in the E3 region is a driver of adenoviral diversity. For example:

  • Recombinant Strain SH2016: A novel HAdV-C strain isolated from a respiratory infection case, recombined between HAdV-1 and HAdV-2 in the E3 region .

  • Breakpoints: Recombination events occur near the E3 12.5 kDa glycoprotein and fiber protein genes, suggesting functional selection pressure .

Production and Handling Guidelines

ParameterRecommendation
ReconstitutionUse deionized sterile water (0.1–1.0 mg/mL); add 5–50% glycerol for long-term storage .
Freezing/ThawingAvoid repeated cycles; store working aliquots at 4°C for ≤1 week .
BufferTris/PBS-based, pH 8.0, with 6% trehalose .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will do our best to fulfill your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, we recommend contacting your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and protein stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type preference, please communicate it to us. We will prioritize the development of your specified tag type.
Synonyms
Early E3A 11.6 kDa glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Human adenovirus C serotype 6 (HAdV-6) (Human adenovirus 6)
Target Protein Sequence
MTGSTIAPTTDYRNTTATGLKSALNLPQVHAFVNDWASLGMWWFSIALMFVCLIIMWLIC CLKRRRARPPIYRPIIVLNPHNEKIHRLDGLKPCSLLLQYD
Uniprot No.

Target Background

Protein Families
Adenoviridae E3A-1 family
Subcellular Location
Host nucleus membrane; Single-pass membrane protein.

Q&A

What is the structural characterization of the Human adenovirus C serotype 6 (HAdV-6) E3A 11.6 kDa glycoprotein?

The HAdV-6 E3A 11.6 kDa glycoprotein is a small membrane protein encoded in the E3 region of the adenovirus genome. Structurally, it shares similarities with the Adenovirus Death Protein (ADP) identified in other species C adenoviruses, particularly HAdV-C2 and HAdV-C5. The protein:

  • Is initially synthesized as a membrane protein with a predicted molecular weight of 11.6 kDa

  • Contains a single signal-anchor sequence (approximately at residues 41-62 based on Ad2/Ad5 homology)

  • Has one potential Asn-linked glycosylation site (position may vary among serotypes, but typically near the N-terminus)

  • Is oriented in cell membranes with its NH2-terminus in the lumen and COOH-terminus in the cytoplasm

  • Migrates as three major groupings of diffuse bands of approximately 14K, 21K, and 31K on SDS-PAGE due to post-translational modifications

The protein undergoes Asn-glycosylation with complex (endo H-resistant) oligosaccharides. While the ADP sequences from HAdV-C2 and HAdV-C5 exhibit 81% sequence identity, the specific sequence variations in HAdV-C6 ADP may influence its functional properties .

How does the E3A 11.6 kDa glycoprotein from HAdV-6 compare to similar proteins in other adenovirus serotypes?

Comparisons between HAdV-6 E3A 11.6 kDa glycoprotein and analogous proteins in other adenovirus serotypes reveal:

  • The signal-anchor and glycosylation features are preserved in Ad2 and Ad5 (group C), and in Ad3 and Ad7 (group B)

  • The sequence of 11.6K is more diverged among these serotypes than most other adenovirus proteins

  • In HAdV-C2 and HAdV-C5, the corresponding proteins (11.6K and 10.5K respectively) show 81% sequence identity

  • The group B adenoviruses (Ad3, Ad7) have a 9-kDa ORF analogous to the Ad2 11.6-kDa ORF, but this region was notably absent from its anticipated location in the Ad35 E3 region

  • Species C viruses (including Ad6) have distinct E3 protein configurations compared to species B, D, and other adenovirus species

Interestingly, phylogenetic analysis of full viral genomes determined that Ad6 is most closely related to Ad2 with 98% homology at the DNA level as determined by Identity Matrix, although Ad6 and Ad1 clustered together in some analyses .

What is the biological function of the E3A 11.6 kDa glycoprotein in HAdV-6?

The E3A 11.6 kDa glycoprotein in HAdV-6 likely functions similarly to its homologs in other species C adenoviruses. Based on research mainly with Ad2 and Ad5 variants:

  • It functions as an "Adenovirus Death Protein" (ADP) that facilitates efficient cell lysis and release of viral progeny

  • It is synthesized in low amounts during early stages of infection but in very high amounts at late stages

  • The protein initially localizes to the endoplasmic reticulum and Golgi apparatus, ultimately localizing to the nuclear membrane

  • Deletion of the E3A 11.6K gene results in smaller plaques in cell culture, indicating its role in cell-to-cell spread of the virus

  • Unlike other E3 proteins that primarily act on infected cells, the E3A 11.6K protein appears to have a direct role in viral egress and spread

It is important to note that while these functions have been well-characterized for Ad2 and Ad5, the specific functions of HAdV-6 E3A 11.6K may have unique aspects due to sequence variations, particularly considering Ad6's distinct liver tropism and lower seroprevalence in humans .

What methods are most effective for expressing and purifying recombinant HAdV-6 E3A 11.6 kDa glycoprotein for functional studies?

Effective expression and purification of recombinant HAdV-6 E3A 11.6 kDa glycoprotein requires consideration of its membrane association and glycosylation properties:

Expression Systems:

  • E. coli expression: Suitable for partial protein fragments or non-glycosylated versions with >85% purity achievable by SDS-PAGE

  • HEK 293-F cell expression: Preferred for full-length, properly glycosylated protein, similar to methods used for other adenovirus glycoproteins

  • Helper-Dependent (HD)-Ad systems: For expression in a viral context, using Cre-expressing 116 cells with serial passage and purification by CsCl banding

Purification Protocol:

  • For E. coli-expressed protein:

    • Centrifuge prior to opening to bring contents to bottom

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C

  • For mammalian cell-expressed protein:

    • Use affinity chromatography with His-tag at the N-terminus

    • Confirm purity by SDS-PAGE (target >90%)

    • Validate biological activity by functional ELISA

Storage Considerations:

  • Shelf life of liquid form is approximately 6 months at -20°C/-80°C

  • Shelf life of lyophilized form is approximately 12 months at -20°C/-80°C

  • Avoid repeated freezing and thawing; store working aliquots at 4°C for up to one week

How can researchers effectively study the role of HAdV-6 E3A 11.6 kDa glycoprotein in immune evasion and viral pathogenesis?

To effectively study the role of HAdV-6 E3A 11.6 kDa glycoprotein in immune evasion and viral pathogenesis, researchers should consider these methodological approaches:

Genetic Manipulation Approaches:

  • Generate recombinant adenovirus vectors with targeted mutations:

    • Create E3A 11.6K deletion mutants to assess its contribution to viral replication and spread

    • Develop chimeric constructs exchanging the E3A 11.6K gene between Ad6 and other species C adenoviruses (Ad1, Ad2, Ad5) to determine serotype-specific functions

    • Modify the homologous sequence between adenovirus and HEK293 genomic DNA to reduce replication-competent adenovirus (RCA) production during vector preparation

Functional Assays:

  • Cell lysis and viral egress assessment:

    • Compare plaque size formation between wild-type and E3A 11.6K-deleted viruses

    • Quantify viral release using qPCR to measure viral genomic DNA copies in culture supernatants

    • Track protein localization during infection using immunofluorescence to monitor movement from ER/Golgi to nuclear membrane

  • Immune response modulation studies:

    • Assess impact on natural killer cell activation and cytotoxicity

    • Measure effects on T cell activation, signaling, and cytokine production

    • Compare with other E3 immunomodulatory proteins to delineate specific functions

Comparative Analysis:

  • Perform side-by-side comparisons of Ad6 E3A 11.6K with homologs from other adenovirus serotypes:

    • Test liver transduction efficiency comparing HD-Ad6 with HD-Ad1, HD-Ad2, and HD-Ad5 vectors

    • Assess the effect of virus-host cell interactions across different cell types, particularly focusing on liver cells where Ad6 shows enhanced tropism

What mechanisms explain the unique liver tropism of HAdV-6 compared to other species C adenoviruses, and how might the E3A 11.6 kDa glycoprotein contribute?

The unique liver tropism of HAdV-6 compared to other species C adenoviruses involves several mechanisms, with possible contributions from the E3A 11.6 kDa glycoprotein:

Key Findings on HAdV-6 Liver Tropism:

  • HAdV-6 was demonstrated to be the most potent species C virus for liver-directed gene therapy, with significantly greater luciferase expression than HD-Ad1, HD-Ad2, and HD-Ad5 (p values of <0.0001, <0.0001, and <0.001, respectively)

  • Quantitative comparison showed HD-Ad6 was approximately 2, 40, and 100-fold better than HD-Ad5, HD-Ad1, and HD-Ad2 in liver transduction

  • Even after intramuscular injection, only HD-Ad6-injected mice showed expression in the liver, suggesting leak of virus into the blood and subsequent infection of hepatocytes

Proposed Mechanisms:

  • Structural differences in viral proteins:

    • The Ad6 fiber protein is three shaft repeats shorter than other species C viruses, which may influence cellular attachment and entry dynamics

    • Differences in hexon hypervariable regions (HVRs) between Ad5/Ad6 and Ad1/Ad2 may relate to differences in charge and length, potentially affecting liver tropism

  • Potential role of E3A 11.6 kDa glycoprotein:

    • May interact differently with host factors during viral assembly and release

    • Could potentially modulate cell signaling pathways that enhance liver cell infection

    • Might contribute to the viral release mechanism, impacting viral spread in hepatic tissue

  • Experimental investigation approaches:

    • Generate chimeric viruses swapping the E3A 11.6 kDa glycoprotein between Ad6 and other species C serotypes to assess its contribution to liver tropism

    • Perform comparative proteomic analysis of infected liver cells to identify differential host responses

    • Use glycosylation inhibitors to determine if post-translational modifications of the E3A 11.6 kDa glycoprotein affect liver cell targeting

How does the glycosylation pattern of the HAdV-6 E3A 11.6 kDa protein impact its function, and what techniques are optimal for characterizing these modifications?

The glycosylation pattern of HAdV-6 E3A 11.6 kDa protein likely has significant impacts on its function, and several techniques can be employed to characterize these modifications:

Functional Impact of Glycosylation:

  • Complex glycosylation causes the protein to migrate as three major groupings of diffuse bands (approximately 14K, 21K, and 31K) on SDS-PAGE, suggesting heterogeneous glycosylation patterns

  • Glycosylation likely affects protein folding, stability, trafficking to the nuclear membrane, and potentially interactions with host cellular factors

  • The single Asn-linked glycosylation site (based on Ad2/Ad5 homology) results in complex (endo H-resistant) oligosaccharides, suggesting processing through the Golgi apparatus

Characterization Techniques:

  • Glycosylation site identification and occupancy:

    • Site-directed mutagenesis of the predicted N-glycosylation site (Asn to Gln substitution)

    • Mass spectrometry (MS) analysis:

      • Enzymatic digestion (trypsin, chymotrypsin) followed by LC-MS/MS

      • Electron transfer dissociation (ETD) for glycopeptide analysis

      • Hydrophilic interaction liquid chromatography (HILIC) for glycopeptide enrichment

  • Glycan structure characterization:

    • Enzymatic release of N-glycans using PNGase F

    • Permethylation followed by MALDI-TOF MS analysis

    • Sequential exoglycosidase digestion to determine glycan sequence and linkage

    • Lectin affinity chromatography to separate different glycoforms

  • Functional impact assessment:

    • Compare wild-type and glycosylation-deficient mutants for:

      • Subcellular localization using immunofluorescence microscopy

      • Protein half-life and stability studies

      • Viral replication efficiency and cell-to-cell spread

    • Inhibit specific glycosylation steps using tunicamycin (N-glycosylation inhibitor) or Golgi-disrupting agents like brefeldin A

What are the optimal experimental designs for evaluating HAdV-6 E3A 11.6 kDa glycoprotein as a component in gene therapy vectors or oncolytic virotherapy?

When evaluating HAdV-6 E3A 11.6 kDa glycoprotein as a component in gene therapy vectors or oncolytic virotherapy, researchers should consider these experimental designs:

For Gene Therapy Vector Development:

  • Vector Construction and Characterization:

    • Generate Helper-Dependent Ad6 (HD-Ad6) vectors expressing transgenes of interest

    • Create variants with wild-type, deleted, or modified E3A 11.6 kDa glycoprotein

    • Compare with analogous HD-Ad1, HD-Ad2, and HD-Ad5 vectors

    • Validate vectors by:

      • Restriction enzyme analysis

      • Sanger sequencing

      • PCR for detection of replication-competent adenovirus (RCA)

  • In Vitro Evaluation:

    • Assess transduction efficiency in relevant target cells (e.g., hepatocytes for liver-directed therapy)

    • Measure transgene expression using luciferase assay, GFP fluorescence, or qPCR

    • Evaluate cytotoxicity using MTT/XTT assays, LDH release, or Annexin V/PI staining

    • Analyze vector pharmacology in different cell types to determine tissue specificity

  • In Vivo Testing Protocol:

    • Administer vectors via appropriate routes:

      • Intravenous injection for liver-directed delivery (10^10 virus particles)

      • Intramuscular injection for localized expression

    • Measure biodistribution using:

      • Bioluminescence imaging for luciferase-expressing vectors

      • qPCR for viral genome quantification in tissues

    • Compare expression levels across different tissues, with particular attention to liver transduction

    • Assess immune responses to the vector and transgene product

For Oncolytic Virotherapy Development:

  • Tumor-Specific Modifications:

    • Modify E3A 11.6 kDa glycoprotein expression to enhance tumor cell lysis

    • Place E3A 11.6 kDa under control of tumor-specific promoters

    • Generate chimeric E3A 11.6 kDa proteins with enhanced lytic activity

  • Evaluation in Cancer Models:

    • Test in multiple cancer cell lines representing different tumor types

    • Compare to Ad5-based oncolytic vectors (current standard)

    • Assess viral replication using qPCR for viral DNA

    • Measure oncolytic activity using:

      • Crystal violet staining for plaque assays

      • Cell viability assays (MTT/XTT)

      • 3D tumor spheroid penetration and killing

  • Immunological Considerations:

    • Evaluate how E3A 11.6 kDa affects immune recognition of infected tumor cells

    • Assess impact on tumor microenvironment using in vitro co-culture systems

    • Determine whether modifications affect neutralizing antibody recognition

    • Consider Ad6's lower seroprevalence as an advantage for patients with pre-existing immunity to Ad5

Key Considerations for Both Applications:

  • Leverage Ad6's naturally enhanced liver tropism for liver-directed therapies

  • Utilize Ad6's lower seroprevalence in humans for potential improved efficacy in patients with pre-existing immunity to Ad5

  • Address safety concerns by implementing strategies to prevent RCA generation during vector production

What quality control measures are essential when working with recombinant HAdV-6 E3A 11.6 kDa glycoprotein?

When working with recombinant HAdV-6 E3A 11.6 kDa glycoprotein, several quality control measures are essential to ensure experimental reproducibility and reliability:

Protein Purity and Integrity Assessment:

  • SDS-PAGE analysis targeting >85-90% purity

  • Western blot confirmation using specific antibodies against the protein or tag

  • Mass spectrometry to confirm protein identity and detect potential contaminants

  • Endotoxin testing, particularly for proteins expressed in E. coli systems

Functional Activity Verification:

  • Binding ability in functional ELISA assays

  • Glycosylation status confirmation using:

    • PNGase F or Endo H treatment followed by mobility shift detection

    • Lectin blotting to characterize glycan composition

  • Proper subcellular localization in transfected/infected cells using immunofluorescence microscopy

Stability Monitoring Protocol:

  • Accelerated stability testing at different temperatures (4°C, 25°C, 37°C)

  • Regular sampling and analysis by SDS-PAGE and activity assays

  • Freeze-thaw stability testing (avoid repeated cycles)

  • Monitoring of aggregation by dynamic light scattering

Storage and Handling Recommendations:

  • Store lyophilized form at -20°C/-80°C for up to 12 months

  • Store liquid preparations at -20°C/-80°C for up to 6 months

  • Prepare working aliquots to avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for no more than one week

Viral Vector-Specific Quality Control:

  • For recombinant adenovirus vectors containing the E3A 11.6 kDa gene:

    • Test for replication-competent adenovirus (RCA) contamination using qPCR

    • Verify transgene expression in appropriate cell lines

    • Confirm viral titer using physical (genome copies by qPCR) and functional (infectious units) methods

    • Monitor genetic stability over passages

How can researchers isolate and analyze the cellular interactions of HAdV-6 E3A 11.6 kDa glycoprotein in infected cells?

To isolate and analyze the cellular interactions of HAdV-6 E3A 11.6 kDa glycoprotein in infected cells, researchers can employ the following methodological approaches:

Protein-Protein Interaction Analysis:

  • Immunoprecipitation methods:

    • Generate specific antibodies against HAdV-6 E3A 11.6 kDa glycoprotein (consider rabbit antipeptide antiserum approach)

    • Perform co-immunoprecipitation from infected cell lysates

    • Use crosslinking agents to stabilize transient interactions

    • Analyze precipitated complexes by mass spectrometry to identify interaction partners

  • Proximity labeling techniques:

    • Generate fusion proteins with BioID or APEX2

    • Express in relevant cell types and activate the enzyme to biotinylate proximal proteins

    • Isolate biotinylated proteins using streptavidin affinity purification

    • Identify interaction partners by mass spectrometry

  • Yeast two-hybrid or mammalian two-hybrid screening:

    • Create bait constructs with the E3A 11.6 kDa protein

    • Screen against human cDNA libraries from relevant tissues

    • Validate hits using co-immunoprecipitation or FRET/BRET assays

Subcellular Localization Studies:

  • Immunofluorescence microscopy protocols:

    • Track the trafficking of E3A 11.6 kDa glycoprotein from ER to Golgi to nuclear membrane

    • Use markers for different cellular compartments:

      • ER markers (calnexin, PDI)

      • Golgi markers (GM130, TGN46)

      • Nuclear membrane markers (lamin B)

    • Perform time-course experiments to observe dynamic changes during infection

  • Cell fractionation approach:

    • Separate cellular components using differential centrifugation

    • Isolate membrane fractions (ER, Golgi, nuclear membrane)

    • Detect E3A 11.6 kDa glycoprotein in different fractions by Western blot

    • Characterize glycosylation state in different compartments

Functional Impact Assessment:

  • Gene editing strategies:

    • Generate CRISPR/Cas9 knockout cell lines for identified interaction partners

    • Assess the impact on E3A 11.6 kDa glycoprotein localization and function

    • Measure viral replication and spread in modified cells

  • Small molecule inhibitors:

    • Target pathways identified through interaction studies

    • Assess effects on viral egress and cell lysis

    • Monitor E3A 11.6 kDa glycoprotein trafficking in the presence of inhibitors

  • Viral mutant characterization:

    • Compare wild-type virus with mutants containing deletions or modifications in the E3A 11.6 kDa gene

    • Assess plaque formation as an indicator of cell-to-cell spread

    • Quantify virus release using qPCR for viral DNA in culture supernatants

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.