Recombinant Human adenovirus C serotype 6 Early E3B 14.5 kDa protein

Shipped with Ice Packs
In Stock

Description

Fundamental Characteristics of E3B 14.5 kDa Protein

The Early E3B 14.5 kDa protein is a transmembrane protein specifically encoded by the Early region 3 (E3) of Human adenovirus C serotype 6 genome. E3 region plays a critical role in viral pathogenesis despite not being essential for viral replication in cell culture systems . This region contains multiple open reading frames that encode proteins involved in modulating host immune responses during infection. Early E3B 14.5 kDa protein is one of these proteins, characterized by its relatively small molecular weight of approximately 14.5 kilodaltons .

The protein has been assigned the UniProt identification number O55655, facilitating its categorization in protein databases and providing a standardized reference for researchers investigating its properties . As part of the E3B subregion, this protein may contribute to the qualitative changes in inflammatory responses observed in adenoviral infections, although its specific mechanisms differ from the well-characterized 19-kDa glycoprotein also encoded within the E3 region .

Taxonomic Classification and Viral Context

Human adenovirus C serotype 6 (HAdV-6) belongs to the Adenoviridae family, specifically within species Human adenovirus C. Adenoviruses are non-enveloped, double-stranded DNA viruses with icosahedral capsids. The Early E3B 14.5 kDa protein is expressed during the early phase of viral infection, preceding viral DNA replication, which is characteristic of proteins encoded by early regions of the adenoviral genome .

Expression Systems and Production Methods

Recombinant Human adenovirus C serotype 6 Early E3B 14.5 kDa protein is typically produced using in vitro E. coli expression systems. The recombinant versions of this protein are frequently engineered with affinity tags to facilitate purification and detection. Specifically, commercially available recombinant forms often feature an N-terminal 10xHis-tag or similar affinity tags .

The expression region typically encompasses amino acids 20-130, representing the mature form of the protein without signal peptides that might be cleaved during natural processing . This approach enables production of a functional protein that retains the essential structural and biochemical properties of the native viral protein.

Physical and Chemical Properties

The recombinant protein is commonly supplied as a lyophilized powder with purity typically exceeding 90% as determined by SDS-PAGE analysis . The formulation often includes stabilizing agents to maintain protein integrity during storage and reconstitution. Standard preparation typically uses a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 .

Table 1: Specifications of Recombinant Human adenovirus C serotype 6 Early E3B 14.5 kDa protein

ParameterSpecification
Protein LengthFull Length of Mature Protein (amino acids 20-130)
Molecular WeightApproximately 14.5 kDa
Expression SystemE. coli
TagN-terminal 10xHis or similar
FormLyophilized powder
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
UniProt IDO55655

The E3 Region in Adenoviral Infection

The Early region 3 (E3) of adenovirus plays a significant role in viral pathogenesis despite not being essential for viral replication in cell culture. Research using cotton rat (Sigmodon hispidus) models of adenovirus pneumonia has demonstrated that mutations in the E3 region can significantly affect the host inflammatory response to infection .

While specific functional data for the 14.5 kDa protein is limited in the provided search results, insights can be drawn from studies of the E3 region more broadly. Mutations in certain E3 proteins, particularly the 19-kDa glycoprotein, have been shown to increase pathogenic effects by interfering with the transport of class I major histocompatibility complex antigens to the surface of infected cells .

Potential Immunomodulatory Functions

The localization of the Early E3B 14.5 kDa protein as a transmembrane protein suggests possible interactions with host cell membranes and potential roles in modulating cellular processes during infection. Proteins from the E3B region have been associated with qualitative changes in inflammatory responses, including alterations in the types of immune cells recruited to infection sites .

Immunological Studies

Recombinant Human adenovirus C serotype 6 Early E3B 14.5 kDa protein serves as a valuable tool for investigating viral-host interactions, particularly in the context of immune response modulation. The purified protein can be used in immunological assays to study its interactions with host proteins and potential effects on immune signaling pathways .

The availability of the protein with affinity tags facilitates its use in protein-protein interaction studies, including co-immunoprecipitation, pull-down assays, and yeast two-hybrid screening, which can help identify host factors that interact with this viral protein .

Comparative Analysis with Related Adenoviral Proteins

Research on the adenovirus E3 region has identified several proteins with immunomodulatory functions. The 19-kDa glycoprotein from this region has been particularly well-characterized and shown to reduce the expression of class I major histocompatibility complex antigens on infected cells . While the Early E3B 14.5 kDa protein shares the same genomic region, its specific functions appear distinct from the 19-kDa glycoprotein.

Studies using mutant adenoviruses have demonstrated that deletions affecting different E3 proteins can result in varying pathological outcomes. For instance, mutants unable to express the 19-kDa glycoprotein show increased inflammatory responses in experimental models, while mutations in other E3 open reading frames may have different effects . This suggests a complex interplay between various E3 proteins in modulating host responses.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us beforehand, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize the development of the specified tag.
Synonyms
Early E3B 14.5 kDa protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-130
Protein Length
Full Length of Mature Protein
Species
Human adenovirus C serotype 6 (HAdV-6) (Human adenovirus 6)
Target Protein Sequence
SQTSAPPKRHISCRFTQIWNIPSCYNKQSDLSEAWLYAIISVMVFCSTIFALAIYPYLDI GWNAIDAMNHPTFPAPNVIPLQQVIAPINQPRPPSPTPTEISYFNLTGGDD
Uniprot No.

Target Background

Function
Down-regulates the EGF receptor and prevents cytolysis by TNF.
Protein Families
Adenoviridae E3_14 family
Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

What is the primary function of the HAdV-C6 E3B 14.5 kDa protein in viral pathogenesis?

The E3B 14.5 kDa protein works in complex with the 10.4 kDa protein to modulate host immune responses. This protein complex is primarily involved in:

  • Down-regulation of cell surface receptors including epidermal growth factor receptor (EGFR)

  • Protection of infected cells from tumor necrosis factor (TNF)-mediated cytolysis

  • Down-modulation of the apoptosis receptor CD95 (Fas, APO-1) on the cell surface

  • Inhibition of Fas-mediated apoptosis in infected cells

This complex functions at the plasma membrane where it induces internalization and lysosomal degradation of target receptors, thereby helping the virus evade host immune surveillance .

How does the structural organization of E3B 14.5 kDa protein contribute to its function?

The E3B 14.5 kDa protein is an integral membrane protein containing specific sorting motifs in its cytoplasmic tail. Research has revealed:

  • It contains YxxΦ sorting motifs that target proteins to endosomal/lysosomal compartments

  • The protein is phosphorylated and O-glycosylated post-translationally

  • It forms a physical complex with the 10.4 kDa protein, and both proteins exhibit mutual interdependence for cell surface expression

  • Trafficking of the protein to the plasma membrane depends on concomitant expression of the 10.4 kDa protein

  • Its membrane topology positions it to interact with cell surface targets like Fas and EGFR

What are the recommended methods for cloning and expressing recombinant HAdV-C6 E3B 14.5 kDa protein?

Based on recent protocols used for adenovirus genome modification, the following approach is recommended:

  • Design of shuttle plasmids: Create a shuttle plasmid containing the E3B region with desired modifications

  • In vitro recombination: Use in-fusion cloning techniques with appropriate restriction enzymes

  • Expression verification: Employ Western blot analysis and immunoprecipitation with antibodies specific to the E3B 14.5 kDa protein

  • Protein purification: Apply affinity chromatography techniques, often using His-tagged versions of the protein

For example, protocols have successfully utilized the In-Fusion HD cloning kit and Clone Amp HiFi PCR premix (Takara Bio) for recombination procedures and amplification steps. This approach allows selective modification of the E3B region without affecting the expression of neighboring genes .

What methods are most effective for detecting and measuring E3B 14.5 kDa protein expression?

MethodApplicationSensitivityAdvantages
Western blotProtein detection1-10 ngAllows visualization of protein size and post-translational modifications
ImmunoprecipitationProtein isolation0.1-1 ngCan detect protein complexes (e.g., with 10.4 kDa protein)
Cell surface labelingLocalization1-10 ngConfirms plasma membrane localization
ImmunofluorescenceCellular distribution1-50 ngVisualizes trafficking patterns within cells
qRT-PCRmRNA expression10-100 copiesQuantifies transcriptional activity of the gene

For optimal results, combine these methods. For instance, researchers have effectively used immunoprecipitation followed by Western blot analysis to demonstrate the complex formation between 10.4 kDa and 14.5 kDa proteins .

How can the E3B 14.5 kDa gene be selectively mutated without affecting expression of neighboring genes?

Selective mutation of the E3B 14.5 kDa gene requires careful consideration of the E3 region's complex splicing patterns. Recommended approaches include:

  • Minimal alterations: Use small insertions (1-4 bp) rather than large deletions to avoid disrupting splicing patterns

  • Start codon mutation: Mutate the ATG start codon to prevent translation without altering mRNA splicing

  • Frame-shift introduction: Create frame shifts that specifically disrupt the 14.5 kDa ORF

  • Expression verification: Confirm that modifications affect only the target gene by assessing expression of neighboring genes (e.g., 10.4 kDa and 14.7 kDa proteins)

Research has shown that deletions within the E3 region can profoundly affect splicing, thereby increasing expression of some E3 proteins while severely reducing expression of others. For example, previous studies demonstrated that selective disruption of the 14.5 kDa ORF did not affect the expression level of E3 products encoded by neighboring E3 genes .

What is the significance of recombination in the E3 region, and how does it impact research on E3B 14.5 kDa protein?

The E3 region has been identified as a hotspot for recombination in adenovirus evolution. This has several implications for E3B 14.5 kDa protein research:

  • Potential for natural variation in the protein sequence across different isolates

  • Opportunities for creating novel variants through directed recombination

  • Concerns regarding stability of E3-modified vectors over multiple passages

  • Challenges in maintaining transgene integrity when inserted into the E3 region

A GC nucleotide content flux has been proposed as a potential marker for homologous recombination sites in adenoviruses, including within the E3 region. This is particularly important for researchers developing adenoviral vectors where transgenes are placed within the E3 cassette, as these might be susceptible to recombination during coinfection with wild-type adenoviruses .

How can researchers assess the immunomodulatory functions of recombinant E3B 14.5 kDa protein?

Several established assays can measure the immunomodulatory functions of E3B 14.5 kDa protein:

  • CD95/Fas surface expression: Flow cytometry analysis of cells expressing E3B 14.5 kDa to quantify Fas down-regulation

  • TNF sensitivity assays: Compare cell viability after TNF treatment between E3B 14.5 kDa-expressing cells and controls

  • EGFR down-regulation assays: Measure EGFR levels by flow cytometry or Western blot in the presence/absence of 14.5 kDa protein

  • Receptor trafficking studies: Track internalization of target receptors using fluorescence microscopy with specific inhibitors of endocytosis

  • Apoptosis resistance measurements: Use annexin V/propidium iodide staining to assess protection from Fas-mediated apoptosis

Studies have shown that the 14.5 kDa protein requires the 10.4 kDa protein to form a functional complex. In experiments with selective gene disruptions, cells expressing mutant E3/14.5K genes showed restored cell surface Fas expression, demonstrating the protein's role in receptor down-regulation .

What protein-protein interactions are critical for E3B 14.5 kDa protein function, and how can they be studied?

Critical protein interactions and methods to study them include:

Interaction PartnerFunctional SignificanceStudy Methods
E3B 10.4 kDa proteinForms functional complex required for all activitiesCo-immunoprecipitation, FRET, cross-linking studies
EGFRTarget for down-regulationSurface biotinylation, receptor internalization assays
CD95/FasTarget for down-regulationFlow cytometry, immunofluorescence microscopy
Endosomal machineryRequired for target receptor traffickingColocalization studies with endosomal markers

Research has established that the 10.4K-14.5K complex binds to Fas on the cell surface and induces its internalization into endosomes/lysosomes where it is degraded. This mechanism is consistent with the presence of YxxΦ sorting motifs in the cytoplasmic tail of 14.5K that target proteins to endosomal/lysosomal compartments .

How can HAdV-C6 E3B 14.5 kDa protein modifications enhance oncolytic virotherapy?

Recent research on HAdV-C6 as an oncolytic vector suggests several strategic modifications of the E3B 14.5 kDa protein:

  • Selective replacement: Substituting the E3B 14.5 kDa coding region with therapeutic transgenes while preserving essential viral functions

  • Immune modulation optimization: Fine-tuning the immunomodulatory functions to enhance anti-tumor immune responses

  • Tissue-specific regulation: Placing the E3B 14.5 kDa under tumor-specific promoter control to restrict its expression to cancer cells

  • Combination approaches: Using E3B modifications alongside other viral genomic changes (e.g., hTERT promoter control of E1A)

A promising approach demonstrated in recent studies involves insertion of the GM-CSF transgene to replace E3-6.7K/gp19K while leaving ADP and E3B region (including 14.5 kDa encoding sequences) intact. This modification was shown to significantly decrease tumor volume and improve survival time in murine models compared to mock-treated controls .

What are the challenges in developing species-specific assays for distinguishing HAdV-C6 E3B 14.5 kDa protein from other adenovirus serotypes?

Developing species-specific assays presents several challenges:

  • Sequence homology: High conservation of the E3B 14.5 kDa protein sequences across adenovirus species C serotypes

  • Cross-reactivity: Antibodies may recognize epitopes shared among different serotypes

  • Functional redundancy: Similar immunomodulatory functions across serotypes despite sequence differences

  • Interaction dependencies: Different requirements for complex formation with 10.4 kDa protein across serotypes

For precise identification, researchers can:

  • Target unique epitopes using monoclonal antibodies against non-conserved regions

  • Develop PCR primers spanning serotype-specific junctions

  • Use proteomic approaches like mass spectrometry to identify signature peptides

  • Apply comparative functional assays to detect subtle differences in receptor modulation

Research comparing species B and C adenoviruses has revealed differences in receptor usage and regulatory mechanisms, suggesting that species-specific characteristics can be exploited for differentiation despite high sequence conservation in some regions .

How does the E3B 14.5 kDa protein differ between HAdV-C6 and other human adenovirus species?

Comparative analysis reveals important differences between HAdV-C6 E3B 14.5 kDa protein and its counterparts in other adenovirus species:

Adenovirus SpeciesE3B 14.5 kDa Key CharacteristicsFunctional Differences
HAdV-C (including C6)Forms complex with 10.4 kDa, targets Fas and EGFRProtection from TNF-mediated cytolysis, down-regulation of EGFR
HAdV-BLess efficient at Fas modulationDifferent receptor tropism (CD46 vs. CAR)
HAdV-DDistinct E3 protein (E3/49K) rather than 14.5 kDaSecreted form targets uninfected leukocytes via CD45
HAdV-AContains CR1 alpha/beta proteins insteadDifferent immunomodulatory strategy

These differences reflect evolutionary adaptations to distinct tissue tropisms and host immune pressures. The E3B 14.5 kDa protein in species C adenoviruses (including HAdV-C6) seems particularly adapted to modulate epithelial cell responses, consistent with their respiratory tract tropism .

What is the evidence for recombination events involving the E3B 14.5 kDa gene in adenovirus evolution?

Several lines of evidence support recombination involving the E3B 14.5 kDa gene:

  • Genomic analyses: Complete genome sequences reveal mosaic patterns consistent with recombination events

  • Proteotype analysis: Multiple unique proteotypes observed for some E3 proteins across different isolates

  • Case studies: Identification of naturally occurring E3-deletion variants, such as the HAdV-7 GZ07 strain with 2864 bp deleted in the E3 region

  • GC content fluctuation: Characteristic patterns of GC nucleotide content at recombination junctions

For example, the first reported case of E3 deletion in human adenovirus was the HAdV-7 GZ07 strain isolated from a child with acute respiratory disease. The deletion resulted in the loss of several E3 proteins while retaining only the left-end proteins (12.1 kDa glycoprotein and 16.1 kDa protein). This finding suggests that the E3 region, including the 14.5 kDa gene, is subject to natural recombination events that may contribute to adenovirus molecular evolution .

What methodological approaches can overcome the challenges in studying E3B 14.5 kDa protein interactions with host receptors?

Advanced methodological approaches include:

  • Cryo-electron microscopy: For high-resolution structural determination of the 10.4K-14.5K complex with target receptors

  • Bioluminescence resonance energy transfer (BRET): To study real-time protein interactions in living cells

  • Proteomics-based interactome mapping: To identify the complete set of host proteins interacting with E3B 14.5 kDa

  • CRISPR-Cas9 screening: To identify host factors required for 14.5 kDa protein function

  • Super-resolution microscopy: To visualize trafficking of receptor complexes at nanoscale resolution

Research has demonstrated that direct binding studies (like Biacore analysis) combined with quantitative microscopy techniques such as Fluorescence Recovery After Photobleaching (FRAP) can effectively characterize protein-receptor interactions in adenovirus research. Similar approaches could be applied to study E3B 14.5 kDa protein interactions with its cellular targets .

How does the immunomodulatory function of E3B 14.5 kDa protein impact the design of HAdV-C6-based oncolytic virotherapies?

The immunomodulatory functions of E3B 14.5 kDa protein present both opportunities and challenges for oncolytic virotherapy:

Advantages to preserve/enhance function:

  • Extended virus persistence in tumor microenvironment

  • Reduced premature clearance by immune system

  • Protection of infected tumor cells from TNF-mediated lysis

Advantages to delete/modify function:

  • Enhanced immune recognition of infected tumor cells

  • Potential for increased immunogenic cell death

  • Opportunity to insert immunostimulatory transgenes

Optimization strategies often involve selective modification rather than complete deletion. For example, researchers have constructed a novel Ad6-hT-GM vector by inserting GM-CSF in place of E3-6.7K/gp19K while preserving other E3 functions. This approach resulted in enhanced anti-tumor effects against human breast cancer xenografts in murine models, significantly decreasing tumor volume and improving survival compared to controls .

What are the potential applications of recombinant E3B 14.5 kDa protein as a therapeutic immunomodulator independent of viral delivery?

The immunomodulatory properties of E3B 14.5 kDa protein suggest potential as a standalone therapeutic:

  • Autoimmune disease management: Inhibition of Fas-mediated apoptosis could reduce tissue damage in autoimmune conditions

  • Transplantation applications: Modulation of host immune responses to reduce rejection

  • Inflammatory disease treatment: Down-regulation of TNF-mediated inflammation

  • Cancer immunotherapy adjuvant: Strategic modulation of immune checkpoint pathways

  • The 14.5 kDa protein requires complex formation with 10.4 kDa for activity

  • Both proteins are membrane-associated, requiring appropriate delivery systems

  • Potential immunogenicity of viral proteins when used as therapeutics

  • Need for cell-type specific targeting to avoid systemic immunosuppression

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.