Recombinant Human Adipogenin (ADIG)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Adipocytes

ADIG is indispensable for LD formation and adipose tissue function:

Lipid Droplet Biogenesis

ADIG promotes LD growth by:

  • Stabilizing Seipin Complexes: ADIG selectively binds dodecameric seipin oligomers, enabling efficient triglyceride (TAG) sequestration .

  • Regulating LD Morphology: Overexpression in adipocytes enlarges LDs, while knockout leads to aberrant LD formation (e.g., smaller, fragmented LDs in brown adipose tissue) .

Experimental ModelLD OutcomeTAG ContentSource
ADIG Overexpression (mice)Enlarged unilocular LDs in WAT/BAT↑ Triglycerides (all species)
ADIG Knockout (mice)Smaller LDs in BAT; delayed clearance↓ Triglycerides in BAT

Thermogenesis and Metabolic Regulation

ADIG enhances cold-induced thermogenesis by:

  • Boosting Triglyceride Uptake: Overexpression in BAT increases TAG absorption from circulation, supporting heat production .

  • Maintaining Core Body Temperature: ADIG-deficient mice show impaired cold tolerance, linked to reduced BAT function .

Genomic and Transcriptional Regulation

ADIG expression is tightly regulated:

  • PPARγ Dependency: ADIG is transcriptionally activated by PPARγ, a master adipogenic regulator, during adipogenesis .

  • Genomic Associations: Variants near ADIG correlate with BMI-adjusted leptin levels, suggesting a role in obesity-related metabolic traits .

Gain-of-Function Studies

Inducible adipocyte-specific ADIG overexpression in mice yields:

ParameterOutcomeSource
Fat Mass↑ BAT, sWAT, and eWAT weights
Lipid Metabolism↑ Triglyceride clearance; ↑ cholesterol in BAT
ThermogenesisAttenuated core body temperature drop (cold exposure)

Loss-of-Function Studies

ADIG knockout in adipocytes results in:

ParameterOutcomeSource
BAT MorphologySmaller LDs; impaired BAT expansion
Cold Tolerance↓ Core body temperature during cold stress
Triglyceride UptakeDelayed clearance in BAT

Mechanistic Insights

ADIG’s role in adipose tissue function is multifaceted:

  1. Seipin Complex Stabilization: ADIG bridges seipin subunits, preventing aggregation and maintaining dodecameric symmetry .

  2. Lipid Droplet Assembly: ADIG may act as part of the lipid droplet assembly complex (LDAC), facilitating TAG storage in high-demand tissues .

  3. Cross-Tissue Metabolic Impact: Overexpression enhances systemic triglyceride metabolism, suggesting therapeutic potential for lipid-related disorders .

Unresolved Questions and Future Directions

  • Human Relevance: Most studies use murine models; human ADIG’s role in obesity or metabolic diseases remains unexplored .

  • Therapeutic Potential: ADIG modulation could target lipid storage disorders or enhance cold-induced energy expenditure .

  • Structural Dynamics: The exact stoichiometry of ADIG-seipin interactions and its evolutionary conservation require further study .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order. We will fulfill your request as much as possible.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ADIG; Adipogenin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-80
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
ADIG
Target Protein Sequence
MKYPLMPLVNDLTFSFLVFWFCLPVGLLLLLIIWLRFLLSQDSEENDSSVCLDWEPWSKG PAEFCWKGTLHGQEKERPCW
Uniprot No.

Target Background

Function
Adipogenin plays a role in stimulating adipocyte differentiation and development.
Gene References Into Functions
  1. Studies in mouse indicate the 80 aa SMAF1 protein is involved in adipocyte tissue function or regulation. PMID: 15567149
Database Links

HGNC: 28606

OMIM: 611396

KEGG: hsa:149685

STRING: 9606.ENSP00000434385

UniGene: Hs.368028

Protein Families
Adipogenin family
Subcellular Location
Membrane; Single-pass membrane protein. Nucleus.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.