Recombinant Human Adiponectin receptor protein 2 (ADIPOR2)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Significance

Recombinant Human Adiponectin Receptor Protein 2 (ADIPOR2) is a laboratory-engineered form of the ADIPOR2 protein, a member of the progestin and adipoQ receptor (PAQR) family. ADIPOR2 is a transmembrane receptor primarily involved in adiponectin signaling, regulating glucose uptake, fatty acid oxidation, and metabolic homeostasis . Recombinant versions are critical for studying its structural, functional, and therapeutic roles.

Functional Insights

ADIPOR2 mediates adiponectin’s metabolic effects via:

  • PPAR-α Pathway Activation: Enhances fatty acid oxidation and insulin sensitivity .

  • Membrane Homeostasis: Acts as a sensor for membrane rigidity, promoting fatty acid desaturation and phospholipid remodeling .

  • Therapeutic Potential: Linked to bone regeneration (via AdipoR1 crosstalk) and liver failure recovery .

Production and Characteristics of Recombinant ADIPOR2

Recombinant ADIPOR2 is produced using diverse systems:

Key Production Systems

  • Wheat Germ: Full-length ADIPOR2 (AA 1-386) with N-terminal GST tag for Western blotting and ELISA .

  • HEK-293 Cells: High-purity (>90%) His-tagged ADIPOR2 for structural studies .

  • E. coli: Truncated forms (e.g., AA 2-155) for antibody development .

Table 2: Recombinant ADIPOR2 Variants

VariantTagHost SystemApplications
AA 1-386GSTWheat germWB, ELISA, affinity purification
AA 1-386His/StrepHEK-293Structural analysis, drug screens
AA 180-367His/GSTE. coliAntibody validation

Mechanistic Studies

  • Signal Transduction: ADIPOR2 activates PPAR-α and AMPK pathways, validated via CRISPR/Cas9 screens and mutant models .

  • Bone Regeneration: Local administration of adiponectin enhances osteogenic markers (BMP-2, ALP) through AdipoR1/2 crosstalk .

Therapeutic Development

  • Liver Failure: SCM-198, a small-molecule agonist, binds ADIPOR2 to activate CaMKII-NOS3 signaling, rescuing mice from acute liver failure .

  • Cancer: Pan-cancer analyses link ADIPOR2 dysregulation to immune infiltration patterns in tumors like PAAD and LIHC .

Controversies and Challenges

  • Data Integrity: Claims of fabricated AdipoR1/2 identification data led to investigations in 2016 .

  • Functional Redundancy: Overlap with ADIPOR1 complicates pathway-specific studies .

Future Directions

  • Drug Optimization: Targeting the ADIPOR2-CaM-CaMKII axis for liver therapeutics .

  • Structural Biology: Resolving ligand-binding mechanisms to design adiponectin mimetics .

Product Specs

Description

Recombinant Human ADIPOR2 protein is produced using an in vitro cell-free expression system derived from *E. coli*. This system employs whole-cell extracts that contain the necessary components for protein synthesis, including transcription, translation, and post-translational modification. By supplementing the cell-free extract with cofactors, the full-length ADIPOR2 protein can be synthesized within a few hours. While this method offers advantages such as protein synthesis without cell culturing and the ability to co-express multiple proteins, it is not suitable for large-scale production.

ADIPOR2 is primarily expressed in the liver. It acts as a receptor for adiponectin, a hormone secreted by adipocytes, and plays a crucial role in regulating glucose and lipid metabolism. Upon binding adiponectin, ADIPOR2 activates PPARα, a nuclear receptor, leading to increased fatty acid catabolism. This process involves upregulating genes responsible for fatty acid transport, binding, activation, and fatty acid β-oxidation in peroxisomes and mitochondria. Conversely, ADIPOR2 deficiency reduces PPARα activity. The sensitivity and resistance to adiponectin mediated by ADIPOR2 in hepatocytes have been shown to modulate steatohepatitis progression by altering PPARα activity and reactive oxygen species (ROS) accumulation.

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for the specific delivery time.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
ADIPOR2; PAQR2; Adiponectin receptor protein 2; Progestin and adipoQ receptor family member 2; Progestin and adipoQ receptor family member II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-386
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSE EHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDF LLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCLGIFYMFRPNISFVAPLQE KVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSGIALLIMGSFVPWLYYSFY CNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGVFLGLGLSGIIPTLHYVISE GFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQLFHIFVVAGAF VHFHGVSNLQEFRFMIGGGCSEEDAL
Uniprot No.

Target Background

Function
ADIPOR2 is a receptor for adiponectin, a crucial hormone secreted by adipocytes that regulates glucose and lipid metabolism. It plays a critical role in maintaining normal body fat and glucose homeostasis. Adiponectin binding to ADIPOR2 triggers a signaling cascade that enhances PPARA activity, ultimately leading to increased fatty acid oxidation and glucose uptake. ADIPOR2 exhibits intermediate affinity for both globular and full-length adiponectin. It is essential for normal revascularization following chronic ischemia caused by blood vessel damage.
Gene References Into Functions
  1. No significant associations were found between ADIPOR2 and diabetes or hypertriglyceridemia in an admixed Latin American population. PMID: 29145541
  2. This case-control study further underscores the role of AdipoR2 genetic polymorphisms (rs10773989 and rs1044471) and its protein expression in colorectal carcinogenesis and progression. PMID: 28765899
  3. Two polymorphisms, rs2241766 in ADIPOQ gene and rs10773989 in ADIPOR2 gene, particularly under the recessive model of inheritance, independently contributed to the susceptibility to myocardial infarction in Han Chinese. PMID: 29524572
  4. Globular adiponectin inhibited the pro-oncogenic effects of leptin by suppressing UHRF1 through AdipoR2-mediated mechanisms. PMID: 28285359
  5. Variants of ADIPOR2 could be a determinant for higher free fatty acid levels, and among Chinese Han population, carriers of the CT and TT genotypes for rs2370055, even with normal glucose levels, may have significantly higher insulin resistance susceptibility. PMID: 27348122
  6. Our findings suggest that PAQR-2 and AdipoR2 proteins share an evolutionarily conserved function in maintaining membrane fluidity in the presence of exogenous saturated fatty acids. PMID: 28886012
  7. Renoprotection by adiponectin is associated with improved endothelial dysfunction, reduced oxidative stress, and upregulation of endothelial nitric oxide synthase expression. This is achieved through activation of adenosine 5'-monophosphate-activated protein kinase by AdipoR1 and activation of peroxisome proliferator-activated receptor (PPAR)-alpha signaling pathway by AdipoR2. [review] PMID: 28402446
  8. The crystal structure of ADIPOR2 bound to a free fatty acid molecule reveals that ADIPOR2 possesses intrinsic basal ceramidase activity, which is enhanced by adiponectin. PMID: 28329765
  9. Adiponectin stimulates cPLA2 and COX-2 expression via AdipoR1/2-dependent activation of PKC/NADPH oxidase/mitochondria, resulting in ROS accumulation, p300 phosphorylation, and histone H4 acetylation. PMID: 27288489
  10. Our results indicate that miR-150 attenuates oxidized low-density lipoprotein-induced lipid accumulation in macrophages by promoting cholesterol efflux. The suppressive effects of miR-150 on macrophage foam cell formation are mediated through targeting of AdipoR2. PMID: 27216461
  11. Decreased expression of ADIPOR2 is associated with polycystic ovary syndrome. PMID: 27075719
  12. Strong Functional Association of adipor2 and cdh13 with adipoq PMID: 25388841
  13. PCR results showed expression of adiponectin, AdipoR1, AdipoR2, follicle-stimulating hormone receptor (FSHR), and luteinizing hormone receptor (LHR) in granulosa cells (GCs). After controlling body mass index (BMI) values, qRT-PCR demonstrated a decreased expression of the adiponectin system in GCs of polycystic ovary syndrome patients compared to controls. PMID: 26631404
  14. Endometriotic stromal cell proliferation is linked to increased expression of AdipoR2 (and AdipoR1) gene receptor expression. PMID: 26459399
  15. Our results identified miR-375 and its direct target, ADIPOR2, as androgen-regulated molecules, suggesting an important role in the mechanism of increased visceral fat mass and associated insulin resistance caused by testosterone deficiency. PMID: 26219823
  16. Two ADIPOR2 SNPs (rs11061925 and rs929434) were associated with fasting plasma triglyceride concentrations in the entire sample of HIV-infected patients. PMID: 26111083
  17. In conclusion, neutrophil AdipoRs (AdipoR1, AdipoR2) upregulation was associated with early stages of vascular injury, hypertension severity, and low serum levels of adiponectin. PMID: 26146630
  18. Results demonstrate that the non-conserved N-terminal trunks dictate the cell-surface expression and temporal signaling profiles of AdipoR1 and AdipoR2. PMID: 25892445
  19. Data indicate the thermal stability of purified N-terminally truncated mutants of adiponectin receptors AdipoR1 and AdipoR2. PMID: 25575462
  20. This study indicated that ApN may play a role in the progression of colorectal adenomatous polyps to carcinoma through actions on adipo-R1 and adipo-R2 receptors. PMID: 25640382
  21. Crystal structures of the human adiponectin receptors AdipoR1 and AdipoR2 at 2.9 Å and 2.4 Å resolution, respectively. PMID: 25855295
  22. Down-regulation of adiponectin receptors (AdipoR1, R2, and T-cadherin) in osteoarthritic chondrocytes. PMID: 24888493
  23. These results strengthen the evidence for the role of AdipoR2 in prostate cancer progression. PMID: 25863129
  24. AA genotype and A allele of rs12342 in the adiponectin receptor 2 gene may increase the risk of ischemic stroke, particularly the risk of atherosclerosis cerebral infarction. PMID: 25299095
  25. miR-423-3p plays a novel oncogenic role in laryngeal cancer via AdipoR2 suppression. PMID: 25337209
  26. In conclusion, all these observations suggest that adiponectin influences bone metabolism by decreasing bone formation levels. PMID: 24673523
  27. The improvement of insulin sensitivity by physical exercise is related to adiponectin and/or AdipoR1/R2 expression changes. PMID: 25126860
  28. Macrophage polarization is a key determinant regulating AdipoR expression and differential APN-mediated macrophage inflammatory responses. PMID: 25392268
  29. In those with advanced-stage gastric cancer, 7 out of 39 had low Adipo-R1 expression (17.9%), and 16 had low Adipo-R2 expression (41%). PMID: 24969908
  30. Low ADIPOR2 expression is associated with hepatocellular carcinoma. PMID: 24619866
  31. AdipoR1 stimulates IL10 production by activating the AMPK and MAPKp38 pathways, whereas AdipoR2 modifies inflammatory processes by activating the COX-2 and PPARG pathways. PMID: 25261236
  32. Adiponectin receptors (Adipor1 and -R2) are located, or re-located, in the plasma membrane with distribution in the cytoplasm when mononuclear cells are committed to differentiate to osteoclasts. PMID: 23971629
  33. AdipoR2 is regulated by the LH receptor function via a cAMP-dependent mechanism. PMID: 23779096
  34. SNPs of both the adiponectin gene and its receptors AdipoR1 and AdipoR2 (including their haplotypes) appear as candidate genes and are involved in the development of insulin resistance. PMID: 23656997
  35. Studies indicate that altered levels of adiponectin and leptin or their cognate receptors in cancers can ultimately lead to an imbalance in downstream molecular pathways. PMID: 23355630
  36. APN, AdipoR1, and AdipoR2 exist in human and mouse retinas, and retinal APN and AdipoR1 protein levels are elevated in type 1 diabetes mellitus mice. PMID: 23922494
  37. Collectively, these studies demonstrate that the non-conserved region of AdipoR2 restricts its cell-surface expression and raise the possibility that the majority of cell-surface AdipoR2 may be present in the form of heterodimers. PMID: 23376713
  38. Data indicate that AdipoR1 was expressed in 27% of primary tumors and AdipoR2 in 47%. PMID: 22907586
  39. High AdipoR2 expression is associated with gastric carcinoma. PMID: 23358721
  40. Circulating concentrations of adiponectin were not affected by type I diabetes, but expression of adiponectin receptors on blood monocytes was markedly reduced and inversely associated with insulin resistance. PMID: 23386639
  41. The pleiotropic, tissue-dependent functions of adiponectin depend on the expression levels of AdipoR1 and AdipoR2. PMID: 23255609
  42. Reduced hepatic expression of adiponectin and adipoR2 might be of pathophysiological relevance in chronic hepatitis B patients with metabolic syndrome. PMID: 22819899
  43. Increased mRNA and protein expression of adiponectin receptors is related to increased aortic stiffness, coronary and peripheral atherosclerosis in patients with coronary artery disease. PMID: 22534793
  44. Adiponectin differentially alters the expression of Adipor1/Adipor2 as well as genes related to steroidogenesis, ovulation, and apoptosis in cumulus cells versus granulosa cells. PMID: 22633650
  45. Adiponectin receptor-2 795G/A polymorphisms and relation with insulin resistance. PMID: 22187345
  46. In a Finnish type 2 diabetes population, four SNPs in ADIPOR2 (rs10848554, rs11061937, rs1058322, rs16928751) are associated with cardiovascular disease risk, and two remain significant. PMID: 21943112
  47. While the decrease in leptin receptor levels in chronic myeloid leukemia patients was confirmed, the increase in AdipoR1 levels and relevant decrease in AdipoR2 levels depicted their possible involvement in chronic myeloid leukemia pathogenesis. PMID: 22082804
  48. Authors evaluated 29 common single-nucleotide polymorphisms (SNP) in ADIPOQ (n = 13), ADIPOR1 (n = 5), and ADIPOR2 (n = 11) in relation to the risk of prostate cancer. PMID: 21960694
  49. Adiponectin suppression of macrophage lipid accumulation/foam cell formation is mediated through AdipoR1/AdipoR2/APPL1. AdipoR1 and AdipoR2 exhibited a differential ability to regulate inflammatory cytokines and SR-A1. PMID: 22227293
  50. In vitro and ex vivo evidence for a causal role of adiponectin in endometrial cancer. PMID: 21980131

Show More

Hide All

Database Links

HGNC: 24041

OMIM: 607946

KEGG: hsa:79602

STRING: 9606.ENSP00000349616

UniGene: Hs.371642

Protein Families
ADIPOR family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitous. Highly expressed in skeletal muscle, liver and placenta. Weakly expressed in brain, heart, colon, spleen, kidney, thymus, small intestine, peripheral blood leukocytes and lung.

Q&A

What is the basic structure of ADIPOR2 and how does it differ from ADIPOR1?

The revised crystal structures show that ADIPOR1 presents large rearrangements of TM5 and icl2 compared to ADIPOR2, with the largest structural difference observed at the α-carbon of M268 TM5 (ADIPOR2) versus R257 TM5 (ADIPOR1) residues, showing a significant 17 Å shift . In the ADIPOR1 structure, TM5 is positioned away from the 7TM hydrophobic core with a 15 Å translation of the intracellular part . These structural differences may reflect distinct functional states or mechanisms despite both receptors possessing ceramidase activity.

What are the primary physiological functions of ADIPOR2?

ADIPOR2 plays critical roles in mediating glucose and lipid metabolism through its function as a receptor for adiponectin . One of its primary molecular functions is its intrinsic ceramidase activity, which catalyzes the hydrolysis of ceramide to produce sphingosine and free fatty acid (FFA) . This enzymatic activity has significant implications for cell signaling, as ceramides and sphingolipids are important bioactive molecules involved in various cellular processes.

ADIPOR2 also activates the ERK1/2 mitogen-activated protein kinase pathway, particularly in vascular smooth muscle cells, vascular endothelial cells, and hepatocytes . This signaling pathway is involved in cellular proliferation and differentiation, suggesting that ADIPOR2 may exert proliferative effects by activating Ras signaling pathways . Additionally, ADIPOR2 has been specifically identified as the main adiponectin receptor responsible for anti-fibrosis effects in liver, indicating its potential role in preventing liver fibrosis .

How can researchers effectively express and purify recombinant ADIPOR2 for structural and functional studies?

For effective expression and purification of recombinant ADIPOR2, researchers should consider a multi-step approach optimized for membrane proteins. Based on successful structural studies, expression systems using HEK293 cells have proven effective for producing functional ADIPOR2 . When crystallizing ADIPOR2, researchers have employed antibody fragment (scFv) co-expression strategies to stabilize the protein structure .

After purification, verification of functional activity should include ceramidase activity assays, as this represents a key function of properly folded ADIPOR2. Researchers should be aware that while ADIPOR2 possesses intrinsic ceramidase activity, this activity is relatively low and enhanced by adiponectin .

How is ADIPOR2 expression dysregulated across different cancer types, and what are the implications for cancer research?

Pan-cancer analysis reveals that ADIPOR2 expression is dysregulated across multiple cancer types, exhibiting both upregulation and downregulation patterns depending on the specific cancer . According to comprehensive studies, ADIPOR2 is upregulated in diffuse large B-cell lymphoma (DLBC), kidney chromophobe (KICH), brain lower grade glioma (LGG), pancreatic adenocarcinoma (PAAD), skin cutaneous melanoma (SKCM), testicular germ cell tumors (TGCT), and thymoma (THYM) . Conversely, it is downregulated in lung adenocarcinoma (LUAD), ovarian serous cystadenocarcinoma (OV), pheochromocytoma and paraganglioma (PCPG), thyroid carcinoma (THCA), uterine corpus endometrial carcinoma (UCEC), and uterine carcinosarcoma (UCS) .

Beyond expression levels, ADIPOR2 demonstrates significant correlations with tumor immune microenvironment factors and multiple immune checkpoint genes. It is predominantly positively correlated with TNFSF15, NRP1, ICOSLG, HHLA2, CD44, CD274, and CD200 . These associations suggest potential implications for immunotherapy response prediction and design, making ADIPOR2 a compelling target for cancer immunology research.

What is the mechanistic basis for ADIPOR2's ceramidase activity, and how can it be experimentally measured?

ADIPOR2's ceramidase activity is mediated through a zinc-dependent hydrolytic mechanism. Crystal structures reveal that ADIPOR2 contains a zinc binding site within its 7TM domain that coordinates the hydrolysis of the amide bond in ceramide . The molecular mechanism involves the positioning of the ceramide substrate such that its amide carbonyl contacts R278 (TM5) and Y328 (TM6) side chains, which function as typical carbonyl polarizing and oxyanion stabilizing residues in zinc-dependent hydrolases . This arrangement exposes the amide carbon to nucleophilic attack by zinc-bound water molecules observed in the crystal structure .

Molecular dynamics simulations provide further insight into the hydrolytic mechanism. In the presence of C18:1 ceramide, a fast rearrangement of the zinc binding site leads to direct coordination changes that facilitate the reaction . The substrate docking studies predict an energetically favorable binding mode of ceramides (C18:1 and C16:0) with the fatty acid moiety positioned within the receptor cavity and the sphingosine part extending into the cavity exposed to the cytoplasm .

For experimental measurement of ADIPOR2's ceramidase activity, researchers typically employ assays using fluorescently labeled ceramide substrates or direct measurement of reaction products (sphingosine and free fatty acids) using mass spectrometry or HPLC. It's important to note that the intrinsic ceramidase activity of ADIPOR2 is relatively low but is enhanced by adiponectin . This suggests that for accurate assessment of full enzymatic capacity, assays should include conditions both with and without adiponectin. Researchers should be aware that mutations in the zinc binding site (e.g., H191 in ADIPOR1 or H202 in ADIPOR2) can disrupt the ceramidase activity .

How do the signaling pathways activated by ADIPOR2 differ from those of ADIPOR1?

Despite their structural similarities, ADIPOR1 and ADIPOR2 exhibit distinct signaling profiles with overlapping yet unique downstream pathways. Both receptors can activate the ERK1/2 mitogen-activated protein kinase pathway, as demonstrated in primary vascular smooth muscle, vascular endothelial cells, and hepatocytes . Interestingly, RNA interference studies have shown that downregulating either ADIPOR1 or ADIPOR2 individually does not attenuate adiponectin-induced ERK1/2 activation, but simultaneous downregulation of both receptors does impair this response . This suggests redundancy in their capacity to activate this particular signaling cascade.

The ERK1/2 activation mechanism involves Src-dependent Ras activation as the dominant pathway, demonstrated by the finding that adiponectin causes rapid, PP2-sensitive activation of Ras, but not the cAMP-regulated small GTPase Rap1 . The signaling cascade also involves APPL1, an adapter protein that mediates ADIPOR1/R2 signaling, as downregulation of APPL1 impairs adiponectin-stimulated ERK1/2 activation .

While both receptors possess ceramidase activity, their structural differences may lead to distinct enzymatic efficiencies or substrate preferences. The revised crystal structures reveal that ADIPOR1 exhibits a more "open" conformation compared to ADIPOR2, which could affect substrate accessibility and processing . Furthermore, ADIPOR2 is more prominently associated with anti-fibrotic effects in liver, suggesting differential tissue-specific functions despite shared molecular activities .

For researchers investigating receptor-specific signaling, it's important to design experiments that can isolate the individual contributions of each receptor, possibly through receptor-specific knockdowns or antagonists combined with pathway-specific readouts.

What are the optimal approaches for studying ADIPOR2-ligand interactions?

Studying ADIPOR2-ligand interactions requires a multi-faceted approach that combines structural, biochemical, and computational methods. Based on successful research strategies, the following approaches are recommended:

For structural studies, X-ray crystallography has proven effective for determining ADIPOR2 structure in complex with ligands . The method involves co-crystallization of ADIPOR2 with ligands such as free fatty acids, which has revealed important binding sites within the receptor . When designing crystallography experiments, researchers should be aware that ADIPOR2 crystals often exhibit weak and highly anisotropic diffraction, necessitating data collection from multiple crystals and careful processing strategies .

Computational methods provide complementary insights into ligand binding. Molecular docking has successfully predicted energetically favorable binding modes for ceramides (C18:1 and C16:0) within ADIPOR2 . These predictions position the fatty acid moiety within the receptor cavity and the sphingosine part extending into the cytoplasm-exposed cavity . Molecular dynamics simulations further enhance understanding by revealing the dynamic behavior of the receptor-ligand complex and conformational changes associated with ligand binding .

Biochemical assays measuring ceramidase activity can indirectly assess ligand binding and functional activation. Since adiponectin enhances ADIPOR2's ceramidase activity, measuring this enhancement can provide insights into receptor-adiponectin interactions . Additionally, binding assays utilizing fluorescently labeled ligands or surface plasmon resonance can directly quantify binding affinities and kinetics.

How can researchers effectively use computational modeling to study ADIPOR2 structure and function?

Computational modeling has emerged as a powerful tool for studying ADIPOR2, particularly when combined with experimental structural data. Based on published research, the following computational approaches have proven valuable:

Molecular docking has successfully identified potential binding modes for ceramide substrates, providing insights into the orientation of these molecules within the ADIPOR2 binding pocket . For optimal results, researchers should use the highest resolution crystal structures available (e.g., the 2.4 Å structure) and docking software such as PLANTS, which has been used effectively in published studies .

All-atom molecular dynamics simulations (MDS) offer deeper insights into the dynamic behavior of ADIPOR2 and its interactions with ligands. These simulations have revealed important conformational changes associated with the hydrolytic mechanism, such as the rearrangement of the zinc binding site in the presence of ceramide substrates . When setting up MDS, researchers should carefully consider both the pre- and post-cleavage states to understand the complete enzymatic cycle .

System preparation for MDS typically involves embedding the receptor-ligand complex in a lipid bilayer to mimic the native membrane environment, followed by solvation and addition of counterions . The resulting system should be energy-minimized and equilibrated before production runs. For studying ADIPOR2's ceramidase activity, simulations of the receptor with intact ceramide as well as with the reaction products (sphingosine and free fatty acid) provide complementary insights .

To ensure biological relevance, computational predictions should be validated against experimental data whenever possible. Mutational studies targeting residues predicted to be important for ligand binding or catalysis can provide crucial validation of computational models.

What techniques are most effective for measuring ADIPOR2 expression and activation in different tissue types?

Measuring ADIPOR2 expression and activation across different tissues requires a combination of molecular, cellular, and physiological techniques. Based on established research methodologies, the following approaches are recommended:

For RNA expression analysis, quantitative PCR (qPCR) remains a gold standard. Public databases such as The Human Protein Atlas (THPA), TIMER2.0, and GEPIA2 have been used extensively to analyze ADIPOR2 expression across normal and tumor tissues . These resources leverage data from repositories like TCGA and GTEx, providing comprehensive expression profiles across multiple tissue types .

Protein-level expression can be assessed using immunohistochemistry or western blotting with antibodies specific to ADIPOR2. The UALCAN database has been utilized to analyze protein levels across tissues, offering a reference point for researchers . When designing immunodetection experiments, it's important to validate antibody specificity, as ADIPOR1 and ADIPOR2 share structural similarities that could lead to cross-reactivity.

For functional activation studies, measuring downstream signaling events provides insights into receptor activity. The ERK1/2 phosphorylation assay has been used successfully to monitor ADIPOR2 activation in response to adiponectin stimulation . This assay can be performed in primary cells from different tissues, providing tissue-specific activation profiles .

Ceramidase activity assays offer a direct measurement of ADIPOR2's enzymatic function. These assays can be performed using crude cell lysates from different tissue types, comparing activity with and without adiponectin stimulation . It's worth noting that both ADIPOR1 and ADIPOR2 possess adiponectin-sensitive intrinsic ceramidase activity, so controls to distinguish between the two receptors are essential .

How does ADIPOR2 expression correlate with tumor microenvironment and immunotherapy response?

ADIPOR2 expression demonstrates significant correlations with the tumor immune microenvironment across multiple cancer types, suggesting potential implications for immunotherapy response prediction. Pan-cancer analysis reveals that ADIPOR2 displays significant associations with cancer stemness, tumor immune microenvironment, and immune checkpoint genes .

Specifically, ADIPOR2 shows predominant positive correlations with several immune checkpoint genes, including TNFSF15, NRP1, ICOSLG, HHLA2, CD44, CD274 (PD-L1), and CD200 . The strong correlation with CD274 (PD-L1) is particularly noteworthy given the central role of PD-L1 in current immunotherapy approaches. These associations suggest that ADIPOR2 expression levels might serve as a biomarker for predicting response to checkpoint inhibitor therapies.

Interestingly, ADIPOR2 is mainly negatively correlated with several TNFR superfamily members, including TNFRSF4, TNFRSF25, TNFRSF14, TMIGD2, CD70, and CD48 . This differential correlation pattern with various immune markers suggests a complex role in modulating the immune microenvironment.

Despite these correlations with immune checkpoint genes, the direct evidence for ADIPOR2's role in predicting immunotherapy response in clinical cohorts remains limited. Researchers investigating this relationship should design studies that specifically assess ADIPOR2 expression in pre-treatment samples from patients receiving immunotherapy and correlate this with response outcomes. Such studies would provide more definitive evidence for ADIPOR2's utility as a predictive biomarker.

What is the relationship between ADIPOR2 and drug sensitivity in cancer treatment?

ADIPOR2 demonstrates significant associations with drug sensitivity across various cancer types, making it a potential biomarker for predicting treatment response and a target for therapeutic intervention. Comprehensive pan-cancer analysis has revealed that ADIPOR2 correlates with sensitivity to various anti-cancer drugs .

While specific drug-ADIPOR2 interactions are not detailed in the available search results, the established correlation suggests several potential mechanisms. First, ADIPOR2's ceramidase activity may influence cellular sphingolipid metabolism, which can affect membrane composition, cellular stress responses, and consequently, drug uptake and efficacy . Second, ADIPOR2-mediated signaling through the ERK1/2 pathway could interact with drug-induced signaling cascades, potentially enhancing or diminishing therapeutic effects depending on the specific drug mechanism .

For researchers investigating the relationship between ADIPOR2 and drug sensitivity, cell-based assays combining ADIPOR2 modulation (overexpression, knockdown, or pharmacological targeting) with drug treatment can provide direct evidence of functional interactions. Drug sensitivity assays using patient-derived xenografts or organoids with varying ADIPOR2 expression levels could offer more translational insights into the clinical relevance of these associations.

The identification of ADIPOR2 as a potential modulator of drug sensitivity opens avenues for combination therapy approaches. For instance, drugs targeting ADIPOR2 or its downstream pathways might sensitize resistant cancer cells to standard chemotherapeutic agents. Further research is needed to identify specific drug classes most affected by ADIPOR2 expression and to develop strategies for exploiting these relationships in clinical settings.

How might targeting ADIPOR2's ceramidase activity offer therapeutic potential for metabolic and inflammatory diseases?

ADIPOR2's intrinsic ceramidase activity represents a promising therapeutic target for metabolic and inflammatory diseases, given the central role of ceramides in these conditions. Ceramides are bioactive lipids implicated in insulin resistance, inflammation, and cellular stress responses, making their metabolism a key intervention point.

The ceramidase activity of ADIPOR2 catalyzes the hydrolysis of ceramide to produce sphingosine and free fatty acid, potentially reducing cellular ceramide levels . This activity is enhanced by adiponectin, suggesting that strategies to increase adiponectin levels or enhance its binding to ADIPOR2 might augment ceramidase activity and improve metabolic outcomes . Understanding the structural basis of this activity, including the zinc binding site and the substrate binding pocket, provides molecular targets for drug development .

Molecular dynamics simulations have revealed key aspects of ADIPOR2's hydrolytic mechanism, including the rearrangement of the zinc binding site and the positioning of ceramide for nucleophilic attack . These insights enable structure-based drug design approaches targeting either the enhancement of ceramidase activity (for conditions where ceramide reduction is beneficial) or its inhibition (where maintaining ceramide levels might be therapeutic).

For inflammatory conditions, ADIPOR2's potential anti-inflammatory effects might operate through multiple mechanisms. By reducing ceramide levels, ADIPOR2 activation could attenuate inflammatory signaling pathways activated by ceramides. Additionally, ADIPOR2's correlations with immune checkpoint genes suggest potential immunomodulatory effects that could be therapeutically exploited .

What are the current gaps in understanding ADIPOR2 function and how might they be addressed?

Despite significant advances in ADIPOR2 research, several critical knowledge gaps remain that warrant further investigation. One primary area requiring clarification is the complete substrate specificity profile of ADIPOR2's ceramidase activity. While it has been established that ADIPOR2 can hydrolyze ceramides, the current research does not fully characterize its enzymatic parameters or preference for different ceramide species . Future studies should systematically evaluate ADIPOR2's activity against ceramides of varying chain lengths and degrees of saturation using quantitative enzyme kinetics approaches.

Another significant gap concerns the precise mechanisms through which adiponectin enhances ADIPOR2's ceramidase activity. While this enhancement has been observed experimentally, the structural and molecular basis for this effect remains unclear . Combined structural studies (e.g., cryo-EM of adiponectin-ADIPOR2 complexes) and biochemical analyses could elucidate how adiponectin binding modulates receptor conformation and catalytic activity.

The physiological significance of the distinct conformational states observed in ADIPOR1 versus ADIPOR2 crystal structures remains to be fully understood . Are these differences reflective of unique functional roles, or do they represent different states within a common catalytic cycle? Time-resolved structural studies and spectroscopic approaches that can capture conformational dynamics may help resolve this question.

Additionally, the tissue-specific functions of ADIPOR2 require further investigation. While ADIPOR2 has been identified as particularly important for anti-fibrotic effects in liver, its roles in other tissues and pathological contexts need clarification . Tissue-specific knockout models and cell type-specific expression analyses would provide valuable insights into these specialized functions.

How might emerging technologies advance our understanding of ADIPOR2 structure-function relationships?

Emerging technologies offer exciting opportunities to address current limitations in ADIPOR2 research and deepen our understanding of its structure-function relationships. Cryo-electron microscopy (cryo-EM) represents a powerful approach for determining the structure of ADIPOR2 in different functional states and in complex with adiponectin or other binding partners. Unlike X-ray crystallography, which provided the initial ADIPOR2 structures but requires crystal formation , cryo-EM can capture proteins in more native-like environments and potentially reveal dynamic conformational changes associated with receptor activation.

Single-molecule fluorescence resonance energy transfer (smFRET) could provide unprecedented insights into the conformational dynamics of ADIPOR2 during substrate binding and catalysis. By strategically placing fluorescent probes on specific domains of the receptor, researchers could monitor real-time structural changes in response to adiponectin binding or during ceramide hydrolysis, potentially resolving the relationship between the distinct conformational states observed in crystal structures .

Advanced computational approaches such as machine learning and artificial intelligence hold promise for predicting ADIPOR2-ligand interactions and identifying novel modulators. Deep learning models trained on existing structural and biochemical data could generate hypotheses about binding modes, substrate preferences, and potential pharmacological targeting strategies that could then be validated experimentally.

CRISPR-based gene editing technologies enable precise manipulation of ADIPOR2 expression and structure in relevant cellular and animal models. CRISPR interference (CRISPRi) or activation (CRISPRa) systems allow for temporal control of ADIPOR2 expression, while base editing or prime editing permit the introduction of specific mutations to probe structure-function relationships without complete gene knockout.

Proteomics approaches, particularly proximity labeling techniques such as BioID or APEX2, could identify the complete interactome of ADIPOR2 in different cellular contexts. These approaches would reveal both stable and transient protein-protein interactions, potentially uncovering new components of ADIPOR2 signaling networks and regulatory mechanisms.

What novel therapeutic approaches targeting ADIPOR2 show the most promise for clinical development?

Emerging therapeutic approaches targeting ADIPOR2 span multiple modalities, each with distinct advantages for clinical development. Small molecule agonists that enhance ADIPOR2's ceramidase activity represent a promising approach for conditions associated with ceramide accumulation, such as metabolic syndrome, non-alcoholic steatohepatitis, and certain neurodegenerative disorders. The detailed structural insights into ADIPOR2's binding pocket and catalytic site provide a foundation for structure-based drug design of such agonists . Computational approaches like molecular docking and dynamics simulations can accelerate the identification of candidates with favorable binding properties and activity profiles .

Adiponectin mimetics offer another innovative approach. Since adiponectin enhances ADIPOR2's ceramidase activity , peptides or small molecules that mimic adiponectin's interaction with the receptor could provide therapeutic benefits while avoiding the challenges associated with protein therapeutics. These mimetics could be designed based on the critical binding interfaces identified through structural and biochemical studies.

For cancer applications, the complex relationship between ADIPOR2 expression and prognosis across different cancer types suggests that both agonistic and antagonistic approaches might be valuable, depending on the specific cancer context . The correlation between ADIPOR2 and immune checkpoint molecules further suggests that combination approaches with existing immunotherapies might enhance efficacy .

Gene therapy approaches targeting ADIPOR2 expression represent a longer-term but potentially transformative strategy. For conditions where ADIPOR2 downregulation contributes to pathology, adeno-associated virus (AAV) vectors carrying the ADIPOR2 gene could restore expression in affected tissues. Conversely, RNA interference or antisense oligonucleotides could reduce ADIPOR2 expression in contexts where it promotes disease progression.

Regardless of the specific approach, therapeutic development should consider the tissue-specific roles of ADIPOR2 and the potential for both on-target and off-target effects. The complex interplay between ADIPOR1 and ADIPOR2 signaling also necessitates careful evaluation of receptor selectivity to achieve the desired therapeutic outcomes while minimizing adverse effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.