Recombinant Human ADP-ribosylation factor-like protein 6-interacting protein 1 (ARL6IP1)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Human ADP-ribosylation Factor-like Protein 6-Interacting Protein 1 (ARL6IP1)

Recombinant Human ARL6IP1 is a laboratory-engineered form of the endogenous protein ARL6IP1, produced for research and therapeutic development. ARL6IP1 is a tetraspan membrane protein critical for endoplasmic reticulum (ER) morphology, mitochondrial-ER interactions, and autophagy regulation. Its recombinant variant enables functional studies and therapeutic exploration in neurodegenerative diseases such as hereditary spastic paraplegia (HSP) and Alzheimer’s disease (AD) .

ER and Mitochondrial Homeostasis

  • Membrane Shaping: ARL6IP1 stabilizes ER tubules by constricting liposomes and counteracting microtubule-dependent ER dynamics .

  • Mitochondria-Associated Membranes (MAMs): Mediates ER-mitochondria tethering, facilitating calcium signaling, lipid transfer, and mitophagy .

Autophagy Regulation

  • LC3B Interaction: Binds LC3B and p62 to promote autophagosome formation, linking ER stress to mitochondrial quality control .

  • Mitophagy: Silencing ARL6IP1 disrupts mitochondrial cholesterol trafficking and ATP production, exacerbating neurodegeneration .

Neurodegenerative Disease Links

  • HSP Pathogenesis: Frameshift mutations (e.g., c.576_579delAAAC) cause autosomal recessive HSP (SPG61), marked by corticospinal tract demyelination .

  • Alzheimer’s Disease: ARL6IP1 knockdown reduces BACE1 translation and Aβ40/42 levels, suggesting therapeutic potential .

In Vitro and In Vivo Models

  • Gene Therapy: AAV9-mediated ARL6IP1 delivery rescues gait abnormalities and neuroinflammation in Arl6ip1 KO mice .

  • Drug Screening: Used to identify compounds like conophylline (CNP), which inhibit BACE1 translation via ARL6IP1-FXR1-5’UTR interactions .

Table 2: Key Research Findings

Study FocusOutcomeSource
ER MorphologyARL6IP1 overexpression induces ER tubule stabilization independent of microtubules
NeuroinflammationArl6ip1 KO mice exhibit white matter demyelination and microglial activation
Autophagy DysregulationARL6IP1 deficiency reduces LC3B-II/p62 complexes and impairs phagophore expansion
Alzheimer’s PathologyARL6IP1 silencing reduces Aβ plaque load and BACE1 expression in APP/PS1 mice

Gene Therapy Development

  • AAV9-ARL6IP1 Delivery: Restores ER-mitochondrial connectivity, reduces limb paraplegia, and improves motor function in HSP models .

  • Target Validation: ARL6IP1’s role in MAMs positions it as a therapeutic node for HSP and AD .

Disease-Associated Mutations

MutationPhenotypeOMIM Entry
c.576_579delAAAC (p.K193Ffs36X)Autosomal recessive HSP (SPG61)607669

Production and Characterization

  • Expression: Recombinant ARL6IP1 is purified from HEK293T cells, achieving >80% purity via affinity chromatography .

  • Functional Assays: Validated using liposome tubulation assays, co-immunoprecipitation (LC3B/BCl2L13 interactions), and mitochondrial flux analyses .

Challenges and Future Directions

  • Therapeutic Optimization: Improving AAV9 delivery efficiency to the central nervous system for broader HSP/AD applications.

  • Mechanistic Studies: Elucidating ARL6IP1’s role in ER-phagy clusters and its interplay with FAM134B .

Product Specs

Form
Lyophilized powder
Note: While we will preferentially ship the format we have in stock, we are happy to accommodate any special format requirements. Please indicate your desired format when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
ARL6IP1; ARL6IP; ARMER; KIAA0069; ADP-ribosylation factor-like protein 6-interacting protein 1; ARL-6-interacting protein 1; Aip-1; Apoptotic regulator in the membrane of the endoplasmic reticulum
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
ARL6IP1
Target Protein Sequence
MAEGDNRSTNLLAAETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLVFLIIY YLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAV GWWKRLFTLKEEKPKMYFMTMIVSLAAVAWVGQQVHNLLLTYLIVTSLLLLPGLNQHGII LKYIGMAKREINKLLKQKEKKNE
Uniprot No.

Target Background

Function
ARL6IP1 positively regulates SLC1A1/EAAC1-mediated glutamate transport by enhancing its affinity for glutamate in a PKC activity-dependent manner. It promotes the catalytic efficiency of SLC1A1/EAAC1 by potentially reducing its interaction with ARL6IP5, a known negative regulator of SLC1A1/EAAC1-mediated glutamate transport. ARL6IP1 plays a crucial role in the formation and stabilization of endoplasmic reticulum tubules. It negatively regulates apoptosis, likely by modulating the activity of caspase-9 (CASP9). It inhibits the cleavage of CASP9-dependent substrates and downstream apoptosis markers, but not CASP9 itself. ARL6IP1 may be involved in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation.
Gene References Into Functions
  1. ARL6ip1 is a three-spanning transmembrane protein with a conophylline binding pocket. PMID: 24076029
  2. Down-regulation of ARL6IP1 expression arrested CaSki cell cycling at the G0/G1 phase and reduced CaSki cell migration, as determined by wound healing assays. PMID: 20213509
  3. ARL6IP1 may play a critical role in cisplatin-induced apoptosis in CaSki cervical cancer cells by regulating the expression of apoptosis-associated proteins. PMID: 20372863
  4. ARL6IP1 is a novel endoplasmic reticulum integral membrane protein that protects cells by inhibiting caspase-9 activity, suggesting a possible role for ARMER in cell survival. PMID: 12754298
Database Links

HGNC: 697

OMIM: 607669

KEGG: hsa:23204

STRING: 9606.ENSP00000306788

UniGene: Hs.634882

Involvement In Disease
Spastic paraplegia 61, autosomal recessive (SPG61)
Protein Families
ARL6ip family
Subcellular Location
Endomembrane system; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum.
Tissue Specificity
Expressed in all hematopoietic cell lineages, but the highest level of expression is found in early myeloid progenitor cells. Expressed in brain, bone marrow, thymus and lung. Expressed at low level in liver, kidney and spleen. Not detected in heart.

Q&A

What is the structural characterization and cellular localization of ARL6IP1?

ARL6IP1 is a tetraspan membrane protein primarily localized to the endoplasmic reticulum (ER). It contains hairpin loop domains that specifically localize to smooth ER tubules and plays an intrinsic role in ER shaping . The protein contains topological domains that are critical for its function, and truncating mutations in these domains can lead to loss of protein function. ARL6IP1 acts as an anti-apoptotic protein specific to multicellular organisms and is a potential player in shaping the ER tubules in mammalian cells .

How does ARL6IP1 function in normal cellular processes?

ARL6IP1 regulates intracellular trafficking pathways in the ER membrane and plays key roles in:

  • Maintaining ER structure and tubular morphology

  • Neuronal development and function, particularly in axonal elongation

  • Regulation of glutamate, a major excitatory neurotransmitter in excitatory synapses

  • Connecting the endoplasmic reticulum and mitochondria as a member of mitochondria-associated membranes (MAMs)

  • Maintaining organelle homeostasis through direct interaction with autophagy regulators like LC3B and BCl2L13

In Drosophila models, knockdown of the gene leads to progressive motor deficit, indicating its evolutionary conserved role in neuronal function .

What is the spectrum of ARL6IP1 mutations associated with hereditary spastic paraplegia (HSP)?

ARL6IP1 mutations cause a range of HSP phenotypes, from moderate to fatal forms. The research identifies specific mutations including:

Mutation TypeProtein ImpactPhenotype Severity
Nonsense variant (c.112C > T)p.Arg38* truncationFatal HSP with neonatal death
Frameshift mutationsProtein lossSevere HSP with neuroinflammation
Other homozygous variantsVariableLate-onset HSP with motor issues

Allelic expression analysis demonstrates downward pressure on mutant alleles, suggesting nonsense-mediated decay mechanisms affect protein expression levels .

How do phenotypes vary among patients with ARL6IP1-associated HSP?

The phenotypic spectrum ranges from milder presentations to severe, fatal forms:

Milder Cases:

  • Late onset of disease (diagnosed at 14 months)

  • Ability to walk with support but with unsteadiness and scissors gait

  • Skeletal deformities including acromutilation (loss of terminal digits)

  • Normal cognition

Severe Cases:

  • Developmental delay, microcephaly, cerebral atrophy

  • Periventricular leukoencephalopathy, partial agenesis of corpus callosum

  • Hypotonia, seizures, spasticity

  • Jejunal stricture, gastrointestinal reflux

  • Distinct dysmorphic features (plagocephaly, prominent nasal bridge, retrognathia)

  • Respiratory distress leading to neonatal death

This broad phenotypic spectrum suggests variable effects of different mutations and potential genetic modifiers.

What animal models exist for studying ARL6IP1 function?

Researchers have developed several ARL6IP1 animal models for investigating its function:

  • Arl6ip1 knockout (KO) mouse model:

    • Generated to represent clinically relevant frameshift mutations

    • Exhibits severe spastic paralysis and gait abnormalities

    • Shows demyelination of axons and neuroinflammation in white matter

    • Displays abnormal hindlimb reflexes where hindlimbs contract toward the trunk

    • Shows progressive motor deficits with significant foot-base angle abnormalities

  • Assessment methods for these models include:

    • Measurement of foot-base angle (decreased to ~45.2° in KO mice compared to ~86.4° in wild-type at 9 months)

    • Footprint analysis to quantify gait abnormalities

    • Histopathological analysis of brain tissue

    • Immunofluorescence and western blot analyses for neural markers

What molecular techniques are most effective for studying ARL6IP1 function?

Research demonstrates several effective methodologies:

  • Gene expression manipulation:

    • Short hairpin RNA (shRNA) to inhibit ARL6IP1 expression in cell lines

    • AAV9-mediated gene delivery for restoration of function in knockout models

  • Gene expression analysis techniques:

    • RT-PCR for mRNA quantification with low cycle amplification (18-20 cycles) to prevent saturation

    • Cloning of RT-PCR products into TOPO vectors for allelic expression analysis

    • Western blotting for protein detection

  • Functional assessments:

    • Cell proliferation and colony formation assays

    • Cell cycle analysis using G0/G1 phase markers

    • Wound healing assays to measure migration capacity

How does ARL6IP1 regulate neuroinflammation?

ARL6IP1 deficiency leads to significant neuroinflammatory changes, as evidenced in knockout models:

  • Altered glial activation patterns:

    • Increased expression of GFAP, a marker of reactive astrocytes

    • Elevated mRNA levels of pan-astrocytes and A1-reactive (neurotoxic) astrocytes

    • Decreased mRNA levels of A2-reactive (neuroprotective) astrocytes

  • Microglial polarization changes:

    • Increased expression of M1 microglia markers (Cxcr3-1, Cd40, Cd80)

    • Decreased expression of most M2 microglia markers (Arg-1, Cd163, Igf-1)

    • Altered M1/M2 polarization, a hallmark of neurodegenerative diseases

  • Inflammatory mediator elevation:

    • Increased levels of proinflammatory cytokines and chemokines

    • Elevated inflammatory proteins in cerebrospinal fluid (BLC, C5/C5α, M-CSF, IL-7, sICAM-1, TIMP-1, TNF-α, JE)

These findings suggest ARL6IP1 plays a critical role in modulating neuroinflammatory responses, with implications for HSP pathogenesis.

What is the relationship between ARL6IP1 and mitochondrial function?

ARL6IP1 plays a crucial role in mitochondrial function through several mechanisms:

  • Mitochondria-associated membrane (MAM) regulation:

    • ARL6IP1 localizes to MAMs, critical contact sites between ER and mitochondria

    • Facilitates exchange of metabolites and signaling molecules between organelles

    • Maintains endoplasmic reticulum and mitochondrial homeostasis

  • Axonal mitochondrial organization:

    • ARL6IP1 contributes to elongation of axonal mitochondria

    • Loss of function disrupts mitochondrial network organization in motor neurons

  • Autophagy regulation:

    • Direct interaction with LC3B and BCl2L13, key autophagy regulators

    • ARL6IP1 silencing causes mitochondrial dysfunction through dysregulated autophagy

These interactions are particularly relevant for neurodegenerative disorders, as MAM dysfunction has been implicated in Alzheimer's disease, amyotrophic lateral sclerosis, Parkinson's disease, and various axonal degeneration diseases .

How can ARL6IP1 be targeted for gene therapy in HSP?

Research demonstrates promising approaches for ARL6IP1-targeted gene therapy:

  • AAV9-mediated delivery system:

    • AAV9-ARL6IP1 delivery reduced limb paraplegia and gait abnormality in mouse models

    • Restored pathophysiological changes in Arl6ip1 knockout models

    • Targeted neuroinflammation, a key pathophysiological change in HSP

  • Therapeutic assessment metrics:

    • Reduction in spastic paralysis symptoms

    • Improvement in gait parameters

    • Reduction in neuroinflammatory markers

    • Restoration of neuronal and glial cell homeostasis

These findings establish ARL6IP1 as a potential target for HSP gene therapy, particularly for addressing the neuroinflammatory component of the disease.

What is the role of ARL6IP1 in cancer biology?

ARL6IP1 demonstrates significant implications in cancer pathophysiology:

  • Effects on cancer cell behavior:

    • Down-regulation of ARL6IP1 inhibits cervical cancer cell proliferation and colony formation

    • Arrests cancer cell cycling at the G0/G1 phase

    • Mitigates cancer cell migration in wound healing assays

  • Molecular pathway regulation:

    • Involvement in cancer cell growth through regulation of apoptotic genes (Caspase-3, Caspase-9)

    • Modulation of tumor suppressor pathways (p53, TAp63)

    • Influence on cell survival signaling (NF-κB, MAPK, Bcl-2, Bcl-xL)

  • Therapeutic implications:

    • ARL6IP1 may serve as a novel therapeutic target for cervical cancer

    • Inhibition strategies could include RNAi or other approaches to down-regulate expression

This research provides evidence that ARL6IP1 has significant biological relevance in cancer progression beyond its neurological functions.

How does ARL6IP1 function intersect with other neurodegenerative diseases?

The role of ARL6IP1 in mitochondria-associated membranes (MAMs) connects it to multiple neurodegenerative conditions:

  • Common pathophysiological mechanisms:

    • Disruption of metabolite and signaling molecule exchange through MAMs

    • Mitochondrial dysfunction and impaired energy metabolism

    • Neuroinflammatory processes including reactive gliosis

  • Disease associations beyond HSP:

    • Alzheimer's disease: MAM dysfunction affects amyloid processing

    • Amyotrophic lateral sclerosis: ER-mitochondria contact sites are altered

    • Parkinson's disease: MAM changes affect mitochondrial quality control

    • Charcot‒Marie‒Tooth disease: shares axonal degeneration mechanisms with HSP

These intersections suggest potential common therapeutic approaches across neurodegenerative disorders that target ER-mitochondria interactions and neuroinflammation.

What are the unresolved questions regarding ARL6IP1 structure-function relationships?

Despite significant advances, several important questions remain:

  • Structural determinants of function:

    • How specific domains contribute to ER tubule shaping

    • Structural requirements for interaction with autophagy regulators

    • Conformational changes during normal function versus disease states

  • Protein interaction network:

    • Comprehensive mapping of ARL6IP1 interactome

    • Identification of tissue-specific binding partners

    • Dynamic changes in protein interactions during development and disease

  • Post-translational modifications:

    • Regulation of ARL6IP1 activity through phosphorylation or other modifications

    • Enzymes responsible for these modifications

    • Impact of modifications on subcellular localization and function

Addressing these questions will require advanced structural biology approaches combined with proteomic analyses and functional studies.

How can ARL6IP1 research contribute to precision medicine approaches for HSP?

Future research on ARL6IP1 could enable personalized therapeutic strategies:

  • Mutation-specific therapies:

    • Developing interventions tailored to specific ARL6IP1 mutations

    • Strategies for nonsense mutation readthrough or exon skipping

    • Approaches for enhancing expression of partially functional proteins

  • Biomarker development:

    • Identification of CSF or blood biomarkers that correlate with disease progression

    • Neuroimaging markers of white matter integrity and neuroinflammation

    • Correlation of biomarkers with specific ARL6IP1 genotypes

  • Combination therapy approaches:

    • ARL6IP1 gene therapy combined with anti-inflammatory agents

    • Mitochondrial support therapies as adjuncts to ARL6IP1-targeted approaches

    • Development of therapeutic regimens based on patient-specific disease mechanisms

These approaches could lead to more effective, personalized treatments for patients with ARL6IP1-associated HSP and related disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.