Recombinant Human ADP-ribosylation factor-like protein 6-interacting protein 6 (ARL6IP6)

Shipped with Ice Packs
In Stock

Description

Introduction

ADP-ribosylation factor-like protein 6-interacting protein 6 (ARL6IP6), also known as AIP-6 or PFAAP1 (Phosphonoformate Immuno-Associated Protein 1), is a protein encoded by the ARL6IP6 gene in humans . The ARL6IP6 gene is located on the long arm of chromosome 2 at 2q23.3 . ARL6IP6 interacts with other proteins and is involved in various cellular processes .

Gene Information

The ARL6IP6 gene spans 43,361 bases, contains 11 exons, and is situated on chromosome 2 at position 2q23.3 in humans . Upstream genes include PRPF40A, FMNL2, and STAM2, while downstream genes are GALNT13, KCNJ3, and NR4A2 . The ARL6IP6 gene is also identified by aliases including AIP6 and PFAAP1 .

Protein Structure and Function

The ARL6IP6 protein contains specific domains and motifs that contribute to its function, and exists in different isoforms due to alternative splicing . ARL6IP6 interacts with ADP-ribosylation factor-like GTPase 6, influencing intracellular trafficking, cell signaling, and apoptosis . It also interacts with FXR1/FXR2 .

Expression

ARL6IP6 exhibits varying expression levels across different tissues, single cell types, and cancer types . Its expression patterns correlate with those of genes within the same cluster . ARL6IP6 expression is observed in both normal and cancerous tissues, with significant differential expression in certain malignancies such as liver cancer .

Role in Diseases

ARL6IP6 plays a role in cancer and Alzheimer's disease . In liver cancer, abnormal expression of ARL6IP6 correlates with tumor grade and patient survival . In Alzheimer's disease, ARL6IP1 (a related protein) mediates the effects of conophylline (CNP), a small molecule that alleviates Alzheimer's pathology by inhibiting BACE1 translation .

Research and Clinical Significance

  • ARL6IP6 in Cancer: ARL-6 expression levels correlate positively with the activity of tumor-infiltrating immune cells . ARL-6 expression is significantly correlated with tumor grade, with the highest expression in grade III tumors .

  • ARL6IP1 in Alzheimer's Disease: ARL6IP1 mediates small-molecule-induced alleviation of Alzheimer pathology through FXR1-dependent BACE1 translation .

Interactions

  • ARL6IP1 interacts with FXR1/FXR2, but not DDX17 or FMR1 .

  • The interaction between ARL6IP1 and FXR1 is enhanced upon CNP treatment, leading to reduced translation of BACE1 .

Table 1: ARL-6 Gene Expression and Immune Cell Infiltration in HCC

Immune CellCorrelation Coefficient (Cor)P-value
Dendritic cells0.2921.95e-8
Neutrophils0.4573.22e-19
Macrophages0.4011.31e-14
CD4+ T cells0.3048.60e-9
CD8+ T cells0.247.41e-6
B cells0.1826.74e-4

Table 2: Comparison of Carcinoma and Para-Carcinoma Tissues

IndexCarcinoma Tissues (N=26)Paired Para-Carcinoma Tissues (N=26)tP value
Mean Density (Mean±SD)0.26±0.050.21±0.036.366<0.0001
H-Score (Mean±SD)159.86±27.99131.36±21.774.759<0.0001
IRS (Mean±SD)6.46±1.984.92±1.723.953<0.001

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ARL6IP6; PFAAP1; ADP-ribosylation factor-like protein 6-interacting protein 6; ARL-6-interacting protein 6; Aip-6; Phosphonoformate immuno-associated protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MSFAESGWRSALRRRGPGTPGPVARPSYSSFTQGDSWGEGEVDEEEGCDQVARDLRAEFS AGAWSEPRKRSVLPPDGNGSPVLPDKRNGIFPAAAGSRAQPRRWPVQVLSILCSLLFAIL LAFLLAIAYLIVKELHAENLKNEDDVDTGLLGFWTLLIISLTAGFSCCSFSWTVTYFDSF EPGMFPPTPLSPARFKKLTGHSFHMGYSMAILNGIVAALTVAWCLM
Uniprot No.

Target Background

Gene References Into Functions
  1. ARL6IP6 identified as a novel candidate gene associated with a syndromic form of CMTC. PMID: 25957586
Database Links

HGNC: 24048

OMIM: 616495

KEGG: hsa:151188

UniGene: Hs.643580

Protein Families
ARL6IP6 family
Subcellular Location
Nucleus inner membrane; Multi-pass membrane protein.

Q&A

What is ARL6IP6 and what is its molecular characterization?

ARL6IP6, also known as Phosphonoformate Immuno-Associated Protein 1 (PFAAP1), is a protein encoded by the ARL6IP6 gene in humans. It functions as an ADP-ribosylation factor-like protein 6-interacting protein . The protein is characterized by multiple phosphorylation sites, particularly on serine, threonine, and tyrosine residues, suggesting its involvement in complex signaling networks . Current research indicates potential roles in cellular transport mechanisms and interaction with GTPase signaling pathways, though the precise molecular function remains under investigation.

What is the genomic structure and location of the ARL6IP6 gene?

The ARL6IP6 gene spans 43,361 bases and contains 11 exons. It is located on the long arm of chromosome 2 at position 2q23.3 . The gene spans from 152,717,893 to 152,761,253 on the plus strand . Its genomic context includes three upstream genes (PRPF40A, FMNL2, and STAM2) and three downstream genes (GALNT13, KCNJ3, NR4A2) that define the identity of this genomic region . This chromosomal positioning provides important context for researchers conducting genomic studies or investigating potential regulatory elements.

What are the known post-translational modifications of ARL6IP6?

ARL6IP6 undergoes extensive post-translational modification, primarily phosphorylation at multiple sites. Based on analysis from databases including HPRD, PhosphoSitePlus, and UniProt, the following phosphorylation sites have been identified:

SitePTM TypeConfidence ScoreSource DatabasesPMIDs
S2PhosphorylationScore 2HPRD, PhosphoSitePlus, UniProt18691976, 20068231
S6PhosphorylationScore 1PhosphoSitePlus-
S10PhosphorylationScore 1PhosphoSitePlus-
T19PhosphorylationScore 2HPRD, PhosphoSitePlus19007248
S27PhosphorylationScore 1PhosphoSitePlus-
S36PhosphorylationScore 2HPRD, PhosphoSitePlus, UniProt18691976
S60PhosphorylationScore 2HPRD, PhosphoSitePlus, UniProt18669648, 20068231
S65PhosphorylationScore 2HPRD, PhosphoSitePlus, UniProt18691976, 18669648, 23186163, 20068231
S80PhosphorylationScore 2HPRD, PhosphoSitePlus, UniProt18691976, 23186163
C168MethylationScore 1IEDB31844290

Additionally, the protein has been shown to undergo methylation at C168, suggesting multiple regulatory mechanisms may control its function .

How do mutations in ARL6IP6 affect protein function?

Several variants affecting PTM sites have been identified, potentially impacting protein function:

SiteVariantSourceDisease Association
S2W2BiomutaPancreatic cancer
S27L27BiomutaOral cavity cancer, Head and neck cancer
T32I32BiomutaSkin cancer

These variants affect key phosphorylation sites, suggesting that disrupted post-translational regulation may contribute to pathogenesis . Researchers investigating ARL6IP6's role in cancer should consider these specific mutations when designing functional studies.

What pathological conditions are associated with ARL6IP6 mutations?

A homozygous truncating mutation in ARL6IP6 has been identified as the likely cause of a syndromic form of Cutis Marmorata Telangiectatica Congenita (CMTC) . This condition is characterized by major dysmorphism, developmental delay, transient ischemic attacks, and cerebral vascular malformations . Additionally, ARL6IP6 has been implicated in cancer pathogenesis, with variants observed in pancreatic, oral cavity, head and neck, and skin cancers .

How does ARL6IP6 relate to ischemic stroke susceptibility?

ARL6IP6 was previously implicated by genome-wide association studies (GWAS) as a susceptibility locus for ischemic stroke in young adults . The identification of ARL6IP6 mutations in CMTC patients with transient ischemic attacks (TIAs) suggests that ischemic stroke may represent the mild end of a phenotypic spectrum that has syndromic CMTC at its severe end . This finding contributes to our understanding of the continuum between Mendelian and complex diseases, which has significant implications for stroke genetics research.

What protein interactions and signaling pathways involve ARL6IP6?

Analysis of ARL6IP6's functional network reveals interactions with 20 genes, including:

  • ARL6IP1, ARL6IP4, ARL6IP5 (related ARL6-interacting proteins)

  • ATL2 (involved in endoplasmic reticulum dynamics)

  • BBIP1 (BBSome-interacting protein)

  • UNC50 (Golgi apparatus protein)

  • CEP19 (centrosomal protein)

  • ATXN10 (ataxin 10)

  • IQCB1 (IQ motif containing B1)

These interactions suggest involvement in several biological processes including:

  • Primary cilium development

  • Ciliary landscape maintenance

  • Extra-nuclear estrogen signaling

  • Regulation of protein-containing complex disassembly

  • Signaling via RHOBTB3 and Rho GTPases

  • Organelle localization

  • Regulation of intracellular transport

  • Protein dephosphorylation and phosphorylation regulation

What is the relationship between ARL6IP6 and the ARL6 gene?

It's important for researchers to distinguish between ARL6IP6 (ADP-ribosylation factor-like protein 6-interacting protein 6) and ARL6 itself (ADP Ribosylation Factor Like GTPase 6). While ARL6IP6 interacts with ARL6, they are distinct genes with different functions. ARL6 (also known as BBS3) is associated with Bardet-Biedl Syndrome 3 and Retinitis Pigmentosa 55, and is involved in organelle biogenesis, maintenance, and cargo trafficking to the periciliary membrane . Understanding this distinction is crucial for researchers to avoid conflating the roles and functions of these related but distinct proteins.

What are effective methods for studying ARL6IP6 expression in tissue samples?

For studying ARL6IP6 expression in tissue samples, researchers should consider multiple complementary approaches:

  • RNA-based methods:

    • RT-qPCR for quantitative mRNA expression analysis

    • RNA-seq for comprehensive transcriptome profiling

    • In situ hybridization for spatial expression patterns

  • Protein-based methods:

    • Immunohistochemistry using validated anti-ARL6IP6 antibodies

    • Western blotting for protein level quantification

    • Mass spectrometry for proteomic analysis and PTM identification

  • Database-assisted analysis:

    • UALCAN for comparing expression across normal tissues, cancer tissues, and different malignancies

    • TIMER database for analyzing immune cell infiltration in relation to ARL6IP6 expression

When designing experiments, researchers should include appropriate controls and consider potential tissue-specific differences in expression patterns.

How can recombinant ARL6IP6 be produced for experimental studies?

Production of recombinant human ARL6IP6 typically involves:

  • Expression system selection:

    • Prokaryotic (E. coli) systems for high yield but potential issues with post-translational modifications

    • Eukaryotic systems (mammalian cells, insect cells) for proper folding and modifications

  • Cloning strategy:

    • Optimize codon usage for the chosen expression system

    • Include appropriate tags (His, GST, FLAG) for purification

    • Consider fusion partners to enhance solubility

  • Purification approach:

    • Affinity chromatography based on chosen tags

    • Size exclusion chromatography for higher purity

    • Ion exchange chromatography for charged variants separation

  • Validation methods:

    • SDS-PAGE and Western blotting

    • Mass spectrometry for identity confirmation

    • Functional assays to verify activity

For optimal results, researchers should consider the specific experimental requirements, including whether post-translational modifications are essential for the intended functional studies.

What are effective approaches for ARL6IP6 knockdown studies?

For effective ARL6IP6 knockdown studies, researchers have successfully employed siRNA-based approaches as documented in hepatocellular carcinoma research . The methodology includes:

  • siRNA design and validation:

    • Proven effective siRNA sequence: 5'-GAATGGTTGTGGCCAAAGA-3'

    • Control siRNA sequence: 5'-TTCTCCGAACGTGTCACG-3'

  • Cell culture conditions:

    • Culture cells in high-glucose (4.5 g/l) Dulbecco's modified Eagle medium

    • Supplement with 10% fetal bovine serum

    • Maintain at 37°C in a humidified incubator with 5% CO₂

  • Transfection protocol:

    • Seed cells at 1×10⁵ cells/well for 24 hours

    • Expose to siRNA fragments and control siRNAs using appropriate transfection reagents

  • Validation of knockdown:

    • RT-qPCR for mRNA reduction confirmation

    • Western blot for protein depletion verification

    • Functional assays to assess phenotypic consequences

When designing knockdown experiments, consider cell type-specific transfection efficiency and optimize conditions for each experimental system.

How should phenotypic analyses be designed for ARL6IP6 functional studies?

Based on current research, phenotypic analyses for ARL6IP6 functional studies should focus on:

  • Cell invasion assays:

    • Transwell migration/invasion assays

    • Wound healing assays

    • 3D matrix invasion models

  • Cell proliferation assessment:

    • MTT/WST-1 assays for metabolic activity

    • BrdU incorporation for DNA synthesis

    • Colony formation assays for long-term proliferative capacity

  • Apoptosis measurements:

    • Annexin V/PI staining for flow cytometry

    • Caspase activity assays

    • TUNEL assay for DNA fragmentation

  • Vascular phenotypes (given CMTC association):

    • In vitro angiogenesis assays

    • Vascular permeability tests

    • Endothelial cell behavior studies

  • Immune cell interaction studies:

    • Co-culture systems with B cells, myeloid dendritic cells, macrophages, neutrophils, CD8+T cells, and CD4+T cells

    • Cytokine profiling

    • Immune cell activation assays

These phenotypic analyses should be tailored based on the specific hypothesis being tested and the cell/tissue types relevant to the research question.

What are emerging roles of ARL6IP6 in disease pathogenesis?

Recent research has revealed several emerging roles for ARL6IP6 in disease pathogenesis:

  • Vascular disorders:

    • ARL6IP6 mutations are associated with Cutis Marmorata Telangiectatica Congenita (CMTC), characterized by vascular anomalies

    • The gene's role in transient ischemic attacks suggests involvement in cerebrovascular regulation

  • Cancer biology:

    • ARL6IP6 variants have been identified in multiple cancer types, including pancreatic, oral cavity, head and neck, and skin cancers

    • Research indicates potential roles in cancer cell invasion, proliferation, and apoptosis

  • Immune system modulation:

    • Positive correlations exist between ARL6IP6 expression and activities of tumor-infiltrating immune cells, including B cells, myeloid dendritic cells, macrophages, neutrophils, CD8+T cells, and CD4+T cells

  • Developmental processes:

    • The association with developmental delay in CMTC patients suggests potential roles in neurological development

These emerging roles provide promising avenues for future investigation, particularly in developing targeted therapies for vascular disorders and potential biomarkers for cancer prognosis.

What therapeutic implications does ARL6IP6 research suggest?

Based on current understanding of ARL6IP6 function and disease associations, several therapeutic implications emerge:

  • Biomarker development:

    • ARL6IP6 expression levels may serve as prognostic indicators in hepatocellular carcinoma and potentially other cancers

    • Expression profiles could guide personalized treatment approaches

  • Target identification:

    • The involvement in multiple signaling pathways suggests potential for targeted drug development

    • Modulation of ARL6IP6 function could affect primary cilium development, intracellular transport, and protein phosphorylation pathways

  • Genetic counseling applications:

    • Identification of ARL6IP6 mutations in families with CMTC provides opportunities for genetic counseling

    • Understanding the relationship between ARL6IP6 variants and stroke risk could inform preventative care strategies

  • Immunotherapy considerations:

    • The correlation between ARL6IP6 expression and immune cell infiltration suggests potential implications for immunotherapy response

Future research should aim to validate these potential therapeutic applications through preclinical models and eventually clinical studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.