Recombinant Human ADP/ATP translocase 4 (SLC25A31)

Shipped with Ice Packs
In Stock

Description

Functional Insights

ANT4 is essential for male fertility, as demonstrated by Ant4-deficient mice exhibiting spermatogenic failure due to mitochondrial dysfunction . Mechanistically, ANT4:

  • Maintains Mitochondrial Membrane Potential: By importing cytosolic ATP into sperm mitochondria .

  • Inhibits Apoptosis: Reduces permeability transition pore (PTPC) opening, preventing chromatin fragmentation .

  • Tissue Specificity: Predominantly expressed in testes, with trace levels in the liver and brain .

Table 2: Functional Comparison of ANT Isoforms

IsoformGeneTissue ExpressionKey Role
ANT1SLC25A4Heart, muscleCardiac energy metabolism
ANT2SLC25A5UbiquitousGeneral cellular ATP synthesis
ANT3SLC25A6UbiquitousBackup for ANT2
ANT4SLC25A31Testis (primary)Spermatogenesis, apoptosis inhibition

Recombinant Expression Systems

Recombinant ANT4 is typically produced in E. coli or HEK293 cells with affinity tags (e.g., His-tag) for purification . Key production parameters include:

  • Expression Hosts: E. coli (most common), HEK293, mammalian cells .

  • Purity: >90% via SDS-PAGE .

  • Storage: Lyophilized powder stable at -80°C; reconstitution in Tris/PBS buffer with trehalose .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly include your request in the order notes. We will strive to fulfill your demand.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquotting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
SLC25A31; AAC4; ANT4; SFEC; ADP/ATP translocase 4; ADP,ATP carrier protein 4; Adenine nucleotide translocator 4; ANT 4; Solute carrier family 25 member 31; Sperm flagellar energy carrier protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-315
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MHREPAKKKAEKRLFDASSFGKDLLAGGVAAAVSKTAVAPIERVKLLLQVQASSKQISPE ARYKGMVDCLVRIPREQGFFSFWRGNLANVIRYFPTQALNFAFKDKYKQLFMSGVNKEKQ FWRWFLANLASGGAAGATSLCVVYPLDFARTRLGVDIGKGPEERQFKGLGDCIMKIAKSD GIAGLYQGFGVSVQGIIVYRASYFGAYDTVKGLLPKPKKTPFLVSFFIAQVVTTCSGILS YPFDTVRRRMMMQSGEAKRQYKGTLDCFVKIYQHEGISSFFRGAFSNVLRGTGGALVLVL YDKIKEFFHIDIGGR
Uniprot No.

Target Background

Function
ADP/ATP antiporter 4 (SLC25A31) is a mitochondrial inner membrane protein that plays a crucial role in cellular energy metabolism. It mediates the exchange of ADP and ATP between the mitochondrial matrix and the cytoplasm. This process is essential for ATP synthesis, which powers cellular activities. SLC25A31 operates via an alternating access mechanism, where a single substrate-binding site is exposed alternately to either the cytosolic or matrix side of the inner mitochondrial membrane.
SLC25A31 is particularly important for spermatogenesis, where it likely facilitates ADP/ATP exchange in spermatocytes. The high ATP supply from mitochondria is essential for the normal progression of spermatogenesis during early stages of meiotic prophase I, including processes such as DNA double-strand break repair and chromosomal synapsis.
Beyond its primary function as an ADP/ATP antiporter, SLC25A31 also contributes to mitochondrial uncoupling and mitochondrial permeability transition pore (mPTP) activity. SLC25A31 can act as a proton transporter, uncoupling the proton flows via the electron transport chain and ATP synthase, leading to reduced ATP production efficiency and increased mitochondrial thermogenesis. Interestingly, this proton transporter activity is inhibited by ADP/ATP antiporter activity, suggesting a regulatory mechanism where SLC25A31 balances ATP production and thermogenesis.
SLC25A31 also plays a critical role in mPTP opening. The mPTP is a non-specific pore that allows passage of solutes up to 1.5 kDa across the mitochondrial membranes. It is implicated in cell death. While the exact role of SLC25A31 in mPTP formation remains unclear, evidence suggests it may either be a pore-forming component or play a regulatory function.
Gene References Into Functions
  1. Male mice with disruptions of Slc25a31 exhibit sterility and an early meiotic arrest phenotype. PMID: 19556438
  2. Research highlights the specific role of the ANT4 isoform in spermatozoid bioenergetics. PMID: 21827840
  3. Studies define common and distinct biochemical characteristics of ANT4 compared to ANT1, 2, and 3, providing a foundation for investigating its unique adaptation to germ cells. PMID: 21532989
  4. Research highlights a cytoprotective activity of ANT4, contrasting with ANT1 and 3 isoforms, which function as pro-apoptotic, while ANT2 and 4 isoforms demonstrate resistance to death-inducing stimuli. PMID: 20060930
  5. The co-localization of SFEC and glycolytic enzymes in the fibrous sheath supports evidence suggesting that the principal piece of the flagellum can generate and regulate ATP independently from mitochondrial oxidation in the mid-piece. PMID: 17137571

Show More

Hide All

Database Links

HGNC: 25319

OMIM: 610796

KEGG: hsa:83447

STRING: 9606.ENSP00000281154

UniGene: Hs.149030

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein. Membrane; Multi-pass membrane protein. Cell projection, cilium, flagellum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in brain, liver, sperm and testis. In testis, expressed at higher level in spermatocytes, while it is expressed at lower level in spermatogonial cells. Expressed in erythrocytes (at protein level).

Q&A

What is the function of SLC25A31 and how does it differ from other mitochondrial carriers?

SLC25A31 encodes ADP/ATP translocase 4, a critical mitochondrial membrane protein that catalyzes the exchange of cytoplasmic ADP with mitochondrial ATP across the inner membrane . While functionally similar to other ADP/ATP translocases, SLC25A31 has a specialized role in the distal flagellum, serving as a nucleotide shuttle between flagellar glycolysis, protein phosphorylation, and motility mechanisms .

For studying functional differences between SLC25A31 and other family members:

  • Transport assay methodology: Reconstitute purified recombinant SLC25A31 in liposomes loaded with ATP, then measure ADP uptake rates compared to other ANT isoforms using radiolabeled substrates.

  • Tissue expression profiling: Unlike the more ubiquitous ANT isoforms, SLC25A31 shows restricted expression in brain, liver, sperm, and testis tissue, requiring tissue-specific experimental designs .

  • Substrate specificity analysis: While all ANTs transport ADP and ATP, subtle differences in transport kinetics can be evaluated using competitive inhibition assays with ADP/ATP analogs.

Research shows SLC25A31 belongs to the Mitochondrial carrier (TC 2.A.29) protein family and represents the fourth member of the adenine nucleotide translocases, with distinct evolutionary conservation patterns across species including human, mouse, rat, bovine, and chimpanzee .

What tissue expression patterns characterize SLC25A31 and what methodologies best detect its presence?

SLC25A31 exhibits a highly specific expression pattern, predominantly found in the brain, liver, sperm, and testis . This restricted distribution suggests tissue-specific functions that differentiate it from more ubiquitously expressed ADP/ATP translocases.

Recommended detection methodologies:

ApplicationOptimal Antibody TypesTechnical Considerations
Western BlotPolyclonal Abs targeting N-terminal regionsCommonly used for basic expression validation with 35 kDa expected band
IHCUnconjugated antibodies with superior tissue penetrationEffective for localization in testis and brain sections
IFFluorophore-compatible antibodiesBest for subcellular localization within sperm flagellum
ELISAPaired antibodies recognizing different epitopesQuantitative measurement in tissue lysates

When designing experiments to detect SLC25A31:

  • Include positive controls from testis tissue where expression is highest

  • Incorporate negative controls from tissues lacking expression

  • Validate antibody specificity using recombinant protein standards

  • Consider potential cross-reactivity with other ANT family members

The canonical human SLC25A31 protein has 315 amino acid residues with a molecular mass of 35 kDa, which serves as a reference for proper identification in experimental procedures .

What are the optimal systems for producing recombinant SLC25A31 protein for research applications?

Several expression systems have been validated for producing functional recombinant SLC25A31 protein, each with distinct advantages depending on research goals:

Expression SystemAdvantagesLimitationsBest Applications
E. coliHigh yield, cost-effective, rapid productionLimited post-translational modificationsStructural studies, antibody production
YeastProper folding, some post-translational modificationsModerate yieldFunctional assays requiring partial glycosylation
BaculovirusHigher-order eukaryotic processingMore complex setup, higher costTransport studies requiring native-like protein
Mammalian cellMost authentic post-translational modificationsLowest yield, highest costInteraction studies, complex formation analysis
In Vivo BiotinylationSite-specific tagging in E. coliSpecialized equipment neededPull-down assays, protein-protein interaction studies

When producing recombinant SLC25A31:

  • For basic structural characterization, E. coli-expressed protein is sufficient and commercially available as "Recombinant Human ADP/ATP translocase 4 (SLC25A31)" from several suppliers .

  • For transport assays, consider using baculovirus or mammalian expression systems to maintain proper folding and membrane insertion.

  • Include purification tags that can be removed without affecting protein function.

  • Verify protein activity through ADP/ATP exchange assays before proceeding with experiments.

Several vendors offer recombinant SLC25A31 preparations in various host systems, enabling researchers to select the most appropriate form for their specific experimental needs .

How can genetic interaction studies enhance our understanding of SLC25A31 function?

Recent CRISPR-based screens have revealed important insights about SLC25A31's genetic interactions and metabolic context-dependent functions. A systematic approach to studying genetic interactions includes:

  • Dual Cas9 system methodology: Utilize different PAM sequences recognized by SpCas9 and SaCas9 to simultaneously knock out SLC25A31 and potential interacting genes .

  • Media condition variations: Test genetic interactions under multiple metabolic states (glucose, galactose, antimycin) to uncover context-dependent functions .

  • Interaction classification framework:

    • GxE (Gene x Environment) interactions: How SLC25A31 KO affects fitness under specific metabolic conditions

    • GxG (Gene x Gene) interactions: How SLC25A31 KO combined with other gene KOs produces non-additive phenotypes

    • GxGxE (Gene x Gene x Environment) interactions: How genetic interactions change across metabolic environments

Research has shown that SLC25A31 is minimally expressed in certain cell types, serving as a negative control in CRISPR screens designed to identify redundant functions among mitochondrial carriers . This suggests researchers should carefully validate SLC25A31 expression in their specific experimental systems before attributing phenotypes to its function.

The selection of appropriate controls is critical when designing genetic interaction experiments involving SLC25A31:

  • Positive controls: Use known synthetic lethal pairs (e.g., BCL2L1 + MCL1)

  • Negative controls: Include non-expressed genes in the cell type of interest

  • Cutting controls: Incorporate guides targeting non-essential loci to account for DNA damage effects

What methodological approaches can detect SLC25A31's role in mitochondrial disease pathogenesis?

SLC25A31 has been implicated in secondary mitochondrial diseases (SMDs), which arise from mutations in nuclear-encoded genes that influence oxidative phosphorylation assembly and operation . Researchers investigating these connections should consider:

  • Patient cohort selection strategy: Focus on individuals with clinical presentations of mitochondrial dysfunction in tissues where SLC25A31 is predominantly expressed (brain, testis).

  • Sequencing approach optimization:

    • Targeted sequencing of SLC25A31 and related mitochondrial carriers

    • Whole-exome sequencing to identify variants in SLC25A31 and interacting partners

    • RNA-seq to evaluate expression changes in patient tissues

  • Functional validation protocol sequence:

    • Measure ATP/ADP exchange rates in patient-derived fibroblasts

    • Assess mitochondrial membrane potential using potentiometric dyes

    • Evaluate respiratory capacity through oxygen consumption measurements

    • Perform metabolic flux analysis to quantify metabolic pathway alterations

  • Disease model development:

    • Generate patient-specific iPSCs with SLC25A31 mutations

    • Differentiate into relevant cell types (neurons, spermatocytes)

    • Create isogenic controls using CRISPR-Cas9 correction

SLC25A31 has been specifically linked to microcephaly in the literature, suggesting its role in brain development may involve critical energy provision mechanisms during neurogenesis . This association provides a framework for investigating how nucleotide transport defects may contribute to neurodevelopmental disorders.

What strategies can researchers employ to study SLC25A31's role in flagellar function and sperm motility?

SLC25A31's enrichment in sperm and potential role in flagellar energy metabolism makes it an important target for reproductive biology research. A comprehensive investigation would include:

  • Subcellular localization optimization:

    • Immunofluorescence with confocal microscopy to precisely map SLC25A31 distribution within sperm flagellum

    • Super-resolution microscopy to determine proximity to other energy-producing enzymes

    • Immuno-electron microscopy to visualize association with specific flagellar structures

  • Functional sperm analysis methodology:

    • Computer-assisted sperm analysis (CASA) before and after SLC25A31 inhibition

    • Measurement of local ATP concentrations using luciferase-based reporters

    • Microfluorimetric analysis of flagellar calcium dynamics during motility

  • ATP/ADP shuttle mechanism investigation:

    • Develop a model system to test SLC25A31's role as "a nucleotide shuttle between flagellar glycolysis, protein phosphorylation and mechanisms of motility"

    • Use metabolic labeling to track ATP movement within different flagellar compartments

    • Correlate SLC25A31 activity with flagellar bend amplitude and beat frequency

  • Animal model approach:

    • Generate sperm-specific SLC25A31 knockout mice

    • Evaluate fertility parameters and detailed sperm function metrics

    • Perform rescue experiments with wild-type SLC25A31 to confirm specificity

Since SLC25A31 may "serve to mediate energy generating and energy consuming processes in the distal flagellum" , researchers should design experiments that can distinguish local ATP production from mitochondrial-derived ATP transport.

Which antibodies are most reliable for SLC25A31 detection in different experimental applications?

Selecting the appropriate antibody is critical for SLC25A31 research. Based on validated products:

Antibody CodeApplicationsSpecies ReactivityValidation Status
CSB-PA076262ELISA, WBHuman, MouseValidated for basic detection
CSB-PA000884WB, IHC, IF, ELISAHuman, MouseMulti-application validation
APR23177NWBMouse, RatWestern blot validation
APR22580NWB, IHCHuman, Mouse, RatCross-reacts with multiple ANT isoforms

When selecting antibodies for SLC25A31 research:

  • Application-specific considerations:

    • For Western blot: Select antibodies targeting conserved epitopes for highest sensitivity

    • For IHC/IF: Choose antibodies validated specifically for morphological applications

    • For proximity ligation assays: Select antibodies raised in different host species

  • Validation methodology:

    • Confirm specificity using SLC25A31 knockout/knockdown controls

    • Test for cross-reactivity with other ANT family members

    • Verify detection in tissues with known expression (testis) versus negative control tissues

  • Technical optimizations:

    • For mitochondrial proteins, optimize permeabilization conditions

    • Consider native versus denaturing conditions based on epitope accessibility

    • Validate lot-to-lot consistency with standard positive controls

Western Blot remains the most widely used application for SLC25A31 antibodies, while ELISA, Immunofluorescence, and Immunohistochemistry are also common approaches for different research questions .

How can CRISPR-Cas9 technology be optimized for investigating SLC25A31 function?

CRISPR-Cas9 technology offers powerful approaches for studying SLC25A31 with several strategic considerations:

  • Guide RNA design strategy:

    • Target conserved functional domains for complete loss-of-function

    • Design guides with minimal off-target effects using established algorithms

    • Consider PAM site availability in highly conserved regions

    • For dual knockout studies, select compatible Cas9 variants (SpCas9 and SaCas9) that recognize different PAM sequences

  • Experimental design framework:

    • Generate complete knockout cell lines to study core functions

    • Create domain-specific mutations to dissect structure-function relationships

    • Develop inducible knockdown systems for temporal control

    • Employ homology-directed repair to introduce tagged versions for localization studies

  • Phenotypic analysis methodology:

    • Assess mitochondrial membrane potential changes

    • Measure cellular respiration rates in modified media conditions

    • Quantify ATP/ADP ratios in different cellular compartments

    • Evaluate metabolic adaptations through metabolomics

    • Screen for synthetic interactions using dual-guide libraries

  • Validation controls:

    • Include non-cutting controls to account for Cas9 toxicity

    • Use guide RNAs targeting olfactory receptors or other non-essential genes as negative controls

    • Perform rescue experiments with wild-type SLC25A31 to confirm specificity

Recent CRISPR screening approaches have utilized SLC25A31 as a negative control in certain cell types where it's not expressed, which provides methodological guidance for properly controlled experiments .

What metabolic condition variations should be incorporated when studying SLC25A31 function?

Understanding how different metabolic states affect SLC25A31 function is crucial for comprehensive characterization:

  • Media condition experimental design:

    • Glucose media: Represents glycolysis-dominant metabolism

    • Galactose media: Forces cells to rely on OXPHOS

    • Glutamine-only media: Tests mitochondrial glutamine metabolism

    • Antimycin treatment: Inhibits complex III to block OXPHOS

  • Analytical approach for metabolic adaptations:

    • Measure cellular growth rates in each condition

    • Quantify mitochondrial and cytosolic ATP/ADP ratios

    • Monitor membrane potential changes during metabolic shifts

    • Analyze metabolic flux using stable isotope labeling

  • Genetic interaction evaluation framework:

    • Test SLC25A31 knockouts alone and in combination with other genes across different media conditions

    • Classify interactions as GxE, GxG, or GxGxE based on phenotypic outcomes

    • Calculate π-scores to quantify the strength of genetic interactions

  • Redundancy testing methodology:

    • Since SLC25A31 may have redundant functions with other ANT family members, test double knockouts under different metabolic conditions

    • Pay particular attention to conditions that force cells to rely on OXPHOS, where ANT function becomes critical

Research has shown that genetic interactions involving mitochondrial carriers can be strongly influenced by metabolic context, with some synthetic sick interactions only apparent under specific conditions like galactose media that force respiratory metabolism .

How should researchers interpret contradictory data regarding SLC25A31 expression patterns?

Researchers frequently encounter conflicting data about SLC25A31 expression, necessitating robust methodological approaches:

  • Comprehensive validation workflow:

    • Verify antibody specificity using recombinant SLC25A31 and knockout controls

    • Apply multiple detection methods (qPCR, Western blot, immunostaining)

    • Quantify absolute expression levels using calibrated standards

    • Consider developmental timing and cellular differentiation state

  • Cell line selection strategy:

    • Recognize that SLC25A31 expression is highly tissue-specific, concentrated in brain, liver, sperm, and testis

    • Understand that SLC25A31 may be absent in common laboratory cell lines, explaining its use as a negative control in some CRISPR screens

    • Include appropriate positive controls (testis tissue or cell lines) in all experiments

  • Isoform detection methodology:

    • Design primers/antibodies that can distinguish SLC25A31 from other ANT family members

    • Use RNA-seq to identify possible alternative splice variants

    • Consider potential post-translational modifications that may affect detection

  • Technical considerations:

    • For mitochondrial proteins, ensure proper sample preparation preserves mitochondrial integrity

    • Consider subcellular fractionation to enrich for mitochondrial proteins

    • Account for potential differences between mRNA and protein expression levels

When confronted with contradictory data, researchers should systematically evaluate the technical and biological factors that might explain the discrepancies, including differences in detection methods, experimental conditions, and the specific cellular context being studied.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.