Recombinant Human Alkaline phosphatase, placental type (ALPP)

Shipped with Ice Packs
In Stock

Description

Introduction

Alkaline phosphatase (ALP) is a ubiquitous enzyme known for its dephosphorylating activity . In humans, there are at least four distinct yet related alkaline phosphatases: intestinal (ALPI), placental (ALPP), placental-like (ALPPL2), and liver/bone/kidney (ALPL) . The tissue-specific ALPs, including intestinal (ALPI), placental (ALPP) and germinal tissues (ALPG), are produced by genes located on chromosome 2 . Recombinant Human Alkaline Phosphatase, Placental Type (ALPP), also known as placental alkaline phosphatase (PLAP), is produced by the ALPP gene . ALPP is a glycosylated membrane-bound dimeric enzyme tethered to the cell surface via the glycosylphosphatidylinositol (GPI) anchor . It is primarily expressed in the placenta, especially syncytiotrophoblasts and primordial germ cells, starting in early weeks of gestation and continuing to increase its expression throughout pregnancy .

Gene and Structure

The ALPP gene encodes for placental alkaline phosphatase in humans . The coding sequence for ALPP is unique because the 3' untranslated region contains multiple copies of an Alu family repeat . Moreover, this gene is polymorphic, with three common alleles (type 1, type 2, and type 3) that have been well-characterized . Recombinant Human Alkaline Phosphatase (Placental type)/ALPP Protein is expressed from HEK293 with His tag at the C-Terminus and contains Ile23-Asp506 .

Function

Alkaline phosphatase, placental type, is a membrane-bound glycosylated dimeric enzyme, also referred to as the heat-stable form, that is expressed primarily in the placenta, although it is closely related to the intestinal form of the enzyme as well as to the placental-like form . As a result of the GPI linkage, ALPP is shed conditionally from the cell surface and secreted into circulation . In pregnant women, both membrane-bound and soluble ALPP might have local and systemic functional effects during pregnancy .

Immunological Functions

ALPP has been identified as a reliable biomarker of diverse germ cell tumors . In a study, ALPP transgenic mice were generated and tested in the LPS-induced sepsis and male-to-female skin graft rejection models . The results showed that ALPP transgenic mice are more susceptible to intraperitoneal injection of LPS in comparison to control animals . In addition, female ALPP transgenic mice were better at delaying the rejection of male skin grafts . In an in vitro phagocytosis experiment, the addition of exogenous ALPP compromised the phagocytic ability of THP-1 monocytic cells . These results indicate that excess ALPP plays a role in modulating both innate and adaptive immune functions .

Recombinant ALPP and Glyco-optimization

CEVEC Pharmaceuticals announced results of a preclinical study in which CAP Go derived recombinant PLAP showed a significantly prolonged serum-half-life . The glyco-optimised PLAP displayed a four times longer serum half-life in a pivotal rat study in comparison to an earlier recombinant version of the molecule . The PLAP molecule originates from a newly developed cell line of CEVEC’s recently introduced CAP Go technology, which provides for specifically improved glycosylation patterns .

Potential Therapeutic Applications

Various alkaline phosphatase (AP) isoforms are under development for the treatment of acute and chronic inflammatory diseases such as Rheumatoid arthritis . Additionally, chronic degenerative diseases such as Alzheimer’s disease or Amyotrophic lateral sclerosis (ALS or Lou Gehrig’s disease) are being considered promising therapeutic indications for alkaline phosphatases . The molecule developed by CEVEC, a recombinant wild-type version of a fully-human AP with a high, specific activity and a prolonged serum-half life, is expected to become the preferred alternative for these approaches .

ALPP product details

FeatureDetails
ProteinAlkaline Phosphatase (Placental type)/ALPP
SynonymsAlkaline phosphatase; PLAP-1; ALPP; PLAP
AccessionP05187
SpeciesHuman
Amino Acid RangeIle23-Asp506
Molecular WeightThe protein has a predicted MW of 53.8 kDa. Due to glycosylation, the protein migrates to 63-68 kDa based on Bis-Tris PAGE result.
ActivityImmobilized Human Alkaline Phosphatase (Placental type), His Tag at 1ug/ml (100 ul/Well) on the plate. Dose response curve for Anti-Alkaline Phosphatase Antibody, hFc Tag with the EC50 of 2.8ng/ml determined by ELISA (QC Test). See testing image for detail.
Product TagC-His
Expression SystemHEK293
Purity> 95% as determined by Bis-Tris PAGE; > 95% as determined by HPLC
EndotoxinLess than 1 EU per ug by the LAL method.
FormulationLyophilized from 0.22 um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Stability and Storage-20 to -80°C for 12 months as supplied from date of receipt.;-80°C for 3 months after reconstitution.;Recommend to aliquot the protein into smaller quantities for optimal storage. Please minimize freeze-thaw cycles.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ALPP; PLAP; Alkaline phosphatase, placental type; Alkaline phosphatase Regan isozyme; Placental alkaline phosphatase 1; PLAP-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-506
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
IIPVEEENPDFWNREAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVSTVTAARILKGQKK DKLGPEIPLAMDRFPYVALSKTYNVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQ CNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQ EGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAK RQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLS RNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERAGQLTSEEDTLSLVTADHSH VFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYR QQSAVPLDEETHAGEDVAVFARGPQAHLVHGVQEQTFIAHVMAFAACLEPYTACDLAPPA GTTD
Uniprot No.

Target Background

Function
Recombinant Human Alkaline Phosphatase, Placental Type (ALPP) is an alkaline phosphatase enzyme capable of hydrolyzing various phosphate compounds.
Gene References Into Functions

Relevant Research and Applications of Placental Alkaline Phosphatase (PLAP):

  1. Prognostic Biomarker in Osteosarcoma: High serum ALP levels correlate with improved survival rates in osteosarcoma patients (PMID: 29970708).
  2. Pre-eclampsia Indicator: Elevated PLAP concentrations are found in the gingival crevicular fluid of patients with pre-eclampsia (PMID: 26988336).
  3. Marker for Malignant Germ Cell Tumors (MGCTs): SALL4, while not entirely specific, shows higher sensitivity than PLAP in detecting MGCTs post-treatment (PMID: 25906119).
  4. Catalytic Mechanism Studies: Computational methods have been used to investigate the catalytic mechanism of PLAP, utilizing its X-ray crystal structure (PMID: 25409280).
  5. IGFBP-1 Dephosphorylation: Placental explants dephosphorylate IGFBP-1 via PLAP activity (PMID: 24856042).
  6. Therapeutic Applications: Anti-PLAP antibodies hold promise for targeted therapies, potentially delivering cytotoxic drugs, radionuclides, or cytokines (PMID: 24247025).
  7. Recurrent Spontaneous Abortion: The ALPP gene, encoding PLAP, is linked to recurrent spontaneous abortion (PMID: 24296104).
  8. Gastrointestinal Smooth Muscle Neoplasm Marker: The specificity and sensitivity of PLAP expression as a marker for gastrointestinal smooth muscle neoplasms have been studied (PMID: 24043717).
  9. mRNA Targeting: p180 is essential for efficient targeting of ALPP mRNA to the endoplasmic reticulum (PMID: 24019514).
  10. Substrate Specificity: Electrostatic potentials within PLAP's active site contribute to its substrate selectivity (PMID: 21910833).
  11. Osteosarcoma Metastasis: High serum alkaline phosphatase, along with MMP-9, is associated with metastasis in primary osteosarcoma (PMID: 22333159).
  12. Trophoblastic Cell Proliferation: PLAP positively influences DNA replication and acts as a proliferative factor in trophoblastic cells (PMID: 21868091).
  13. Gonadal Tumor Risk Factor: PLAP expression, along with other markers, suggests a link between germ cells and gonadal tumor risk (PMID: 21692598).
  14. Catalytic Mechanism: Further research on the catalytic mechanism of human placental alkaline phosphatase (PMID: 21939286).
  15. Prognostic Factor in Prostate Cancer: Serum alkaline phosphatase, Gleason score, and bone metastasis intensity are significant prognostic factors in prostate cancer (PMID: 19450995).
  16. Adrenocortical Development: PLAP expression is retained in childhood adrenocortical tumors, suggesting a link to embryonal development (PMID: 21516013).
  17. Age Correlation: Serum alkaline phosphatase shows an inverse relationship with age (PMID: 20655896).
  18. Chronic Kidney Disease: High serum alkaline phosphatase is associated with chronic kidney disease (PMID: 20299338).
  19. ALPP Gene Promoter Variation: Variation in the ALPP gene promoter affects PLAP expression (PMID: 20663553).
  20. Ligand Binding Studies: Structural studies of PLAP in complex with ligands (PMID: 20693656).
  21. Osteoblast Response to Strain: Tensile strain influences alkaline phosphatase expression in human osteoblasts (PMID: 19595020).
  22. PLAP Allelic Variations: The PLAP D allele contains specific amino acid substitutions (PMID: 11857742).
  23. GPI-Anchored Protein Proximity: Studies on the proximity of GPI-anchored proteins to the membrane surface (PMID: 12081485).
  24. Aerolysin Target: The beta-N-acetylglucosaminyl phosphate diester residue of PLAP is a target of the aerolysin toxin (PMID: 12851398).
  25. Aeromonas sobria Hemolysin Receptor: PLAP acts as a receptor for Aeromonas sobria hemolysin (PMID: 15715171).
  26. Ligand Complex Analysis: Analysis of human placental alkaline phosphatase in complex with functional ligands (PMID: 15946677).
  27. Parity and Birth Weight: The effect of parity on placental weight and birth weight (PMID: 16431676).
  28. Strontium Substitution: Crystal structure of strontium-substituted human placental alkaline phosphatase (PMID: 16815919).
  29. Membrane Microenvironment Modulation: Membrane microenvironment influences the activity of GPI-anchored enzymes (PMID: 18416535).
  30. Primary Biliary Cirrhosis: Serum alkaline phosphatase, bilirubin, and aspartate aminotransferase are useful for identifying UDCA-treated patients with primary biliary cirrhosis at risk of death or liver transplantation (PMID: 18752324).
  31. Therapy-Related Pediatric Cancer: Elevated alkaline phosphatase is associated with therapy-related pediatric cancer (PMID: 18802949).
Database Links

HGNC: 439

OMIM: 171800

KEGG: hsa:250

STRING: 9606.ENSP00000375881

UniGene: Hs.284255

Protein Families
Alkaline phosphatase family
Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Tissue Specificity
Detected in placenta (at protein level).

Q&A

What is the structural and functional characterization of ALPP?

ALPP is a glycosylated membrane-bound dimeric enzyme tethered to the cell surface via a glycosylphosphatidylinositol (GPI) anchor. It belongs to the family of tissue-specific alkaline phosphatases encoded by genes located on chromosome 2. ALPP is primarily expressed in syncytiotrophoblasts and primordial germ cells, with expression beginning in early gestation and increasing throughout pregnancy .

Unlike the tissue-nonspecific alkaline phosphatase (ALPL/TNAP) that is predominantly expressed in liver, bone, and kidney tissues, ALPP has tissue-specific expression patterns and potentially unique functional roles. ALPP can function both as a membrane-bound enzyme and as a secreted protein following cleavage by specific phospholipases .

How does ALPP expression differ from other alkaline phosphatase isozymes?

ALP IsozymeGene LocationPrimary Expression SitesKey Characteristics
ALPP (Placental)Chromosome 2Placenta, syncytiotrophoblasts, primordial germ cellsIncreases throughout pregnancy; biomarker for germ cell tumors
ALPL (Tissue-nonspecific)Chromosome 1Liver, bone, kidneyPredominant ALP in circulation; mutations linked to hypophosphatasia
ALPI (Intestinal)Chromosome 2Intestinal tissuesTissue-specific functions
ALPG (Germinal)Chromosome 2Germinal tissuesTissue-specific functions

Under normal physiological conditions, ALPL represents the predominant ALP isozyme in circulation, but tissue-specific ALPs like ALPP may contribute to the serum ALP pool under specific conditions such as pregnancy or in certain pathological states .

What are the optimal conditions for recombinant ALPP protein expression and purification?

When expressing recombinant ALPP, researchers should consider the following methodological approach:

  • Expression System Selection: Mammalian expression systems (particularly HEK293 or CHO cells) are preferred over bacterial systems due to the requirement for proper glycosylation and post-translational modifications that affect ALPP functionality.

  • Construct Design: Include the coding sequence for ALPP (minus the C-terminal propeptide which is not present in the mature form) with an appropriate tag (His-tag is commonly used) to facilitate purification.

  • Purification Protocol:

    • Use affinity chromatography (Ni-NTA for His-tagged proteins)

    • Follow with size exclusion chromatography to ensure dimeric structure

    • Maintain buffer conditions at pH 8.0-9.0 for optimal stability

    • Include zinc and magnesium ions in storage buffers as they are essential for enzyme activity

  • Activity Assessment: Using 4-Methylumbelliferyl phosphate (4-MUP) as a substrate, ALPP activity can be measured fluorometrically at excitation/emission wavelengths of 365/445 nm .

Similar to protocols used for ALPL, ALPP enzyme activity assays should be performed in appropriate buffers at alkaline pH (typically 9.0-10.0) for optimal phosphatase activity .

How can researchers establish and validate ALPP transgenic mouse models?

Based on the reported methodology for generating ALPP transgenic mice, researchers should follow these key steps:

  • Transgene Construction: Design a construct containing the human ALPP cDNA under the control of a strong constitutive promoter (such as CMV) to ensure consistent expression.

  • Founder Generation: Perform microinjection of the linearized construct into fertilized mouse oocytes, typically using C57BL/6 background mice.

  • Transgene Verification: Employ PCR analysis to verify successful integration and transmission of the transgene to offspring.

  • Expression Validation:

    • Tissue samples should be analyzed for ALPP expression at both mRNA and protein levels

    • Serum levels of ALPP should be measured to confirm systemic exposure

    • Enzyme activity assays should be performed to confirm functional expression

  • Phenotypic Characterization:

    • Conduct histopathological analysis of major organs

    • Perform flow cytometric analysis of immune cell populations

    • Assess baseline physiological parameters

In previously reported ALPP transgenic models, no significant developmental abnormalities were observed, and major organ systems appeared normal upon histopathological examination .

How does ALPP modulate immune responses in experimental models?

ALPP has been shown to modulate both innate and adaptive immune functions through various mechanisms:

  • Innate Immunity Effects:

    • ALPP transgenic mice showed increased susceptibility to LPS-induced sepsis compared to wild-type controls

    • Age-dependent effects were observed, with older mice (>3 months) being more susceptible than younger mice (<3 months) to LPS challenge

    • Exogenous ALPP treatment significantly compromised the phagocytic ability of THP-1 monocytic cells in vitro

  • Adaptive Immunity Effects:

    • Female ALPP transgenic mice demonstrated delayed rejection of male skin grafts

    • This suggests potential T-cell immunomodulatory effects of ALPP

  • Cytokine Modulation:

    • In LPS-treated mice, G-CSF levels were significantly higher in ALPP transgenic mice compared to wild-type at 7 hours post-LPS administration

    • No significant differences were observed in levels of GM-CSF, IL-1β, IL-4, IL-6, IL-10, IL-13, IFN-γ, and TNF-α

Time Post-LPSG-CSF in WT MiceG-CSF in ALPP Transgenic MiceStatistical Significance
1 hourElevatedElevatedNot significant
3 hoursElevatedElevatedNot significant
5 hoursElevatedElevatedNot significant
7 hoursElevatedSignificantly higherp < 0.05

These findings suggest that ALPP may exert immunomodulatory effects through specific mechanisms that affect both innate immune cell function and adaptive immune responses, potentially through pathways distinct from traditional LPS dephosphorylation .

What are the experimental considerations when studying ALPP in cancer models?

When investigating ALPP in cancer research contexts, researchers should consider:

  • Cancer-Type Specificity:

    • ALPP has been identified as a reliable biomarker for various germ cell tumors including seminoma and dysgerminoma

    • Recent findings suggest elevated ALPP expression in certain hepatocellular carcinomas with enhanced motility, indicating potential pro-tumorigenic roles beyond placental functions

  • Experimental Design Considerations:

    • Include appropriate cancer cell lines known to express ALPP (e.g., germ cell tumor lines)

    • Establish ALPP knockdown and overexpression models to assess functional roles

    • Conduct both in vitro migration/invasion assays and in vivo tumorigenicity studies

    • Assess correlation between ALPP expression and tumor aggressiveness markers

  • Mechanistic Investigation Approaches:

    • Identify potential ALPP-targeted substrates in cancer cells

    • Explore signaling pathways affected by ALPP enzymatic activity

    • Investigate potential interactions between ALPP and tumor microenvironment components

    • Consider both membrane-bound and soluble ALPP forms in experimental designs

  • Translational Research Considerations:

    • Develop methods to detect ALPP in patient samples (serum, tissue biopsies)

    • Evaluate prognostic value of ALPP expression in specific cancer types

    • Explore ALPP as a potential therapeutic target

How should researchers interpret contradictory findings in ALPP immunomodulatory studies?

When encountering contradictory results regarding ALPP's immunomodulatory effects, consider the following analytical approach:

  • Context-Dependent Effects:

    • While ALP isozymes are generally considered anti-inflammatory through dephosphorylation of inflammatory molecules like LPS, ALPP transgenic mice actually showed increased susceptibility to LPS-induced sepsis

    • This apparent contradiction suggests that ALPP may have context-dependent effects or substrate specificity different from other ALP isozymes

  • Methodological Differences Analysis:

    • Evaluate differences in experimental models (in vitro vs. in vivo)

    • Compare ALPP concentration/expression levels between studies

    • Assess differences in stimulus type, duration, and intensity

    • Consider genetic background variations in animal models

  • Mechanistic Explanation Framework:

    • ALPP may dephosphorylate both pro-inflammatory and anti-inflammatory substrates

    • The net effect may depend on the relative abundance of these substrates in different experimental conditions

    • ALPP may have non-enzymatic functions through protein-protein interactions

    • Different immune cell subsets may respond differently to ALPP

  • Integrated Data Interpretation:

    • Construct a comprehensive model that accommodates seemingly contradictory findings

    • Consider temporal dynamics of immune responses

    • Evaluate dose-dependent effects of ALPP

    • Integrate findings across different experimental systems

The apparent contradiction between expected anti-inflammatory effects and observed increased LPS susceptibility in ALPP transgenic mice suggests complex mechanisms worthy of further investigation .

What are the common technical challenges in ALPP activity assays and how can they be addressed?

Researchers frequently encounter the following challenges when performing ALPP activity assays:

  • Specificity Issues:

    • Challenge: Difficulty distinguishing ALPP activity from other ALP isozymes

    • Solution: Use isozyme-specific inhibitors such as L-phenylalanine (inhibits ALPP but not ALPL) or levamisole (inhibits ALPL but not ALPP)

    • Validation: Confirm specificity using recombinant isozymes as positive controls

  • Sensitivity Limitations:

    • Challenge: Low sensitivity with traditional colorimetric substrates like p-nitrophenyl phosphate

    • Solution: Employ fluorescent substrates such as 4-MUP for enhanced sensitivity

    • Protocol: For optimal results, use 50 μM substrate concentration and measure kinetically for 5 minutes at excitation/emission wavelengths of 365/445 nm

  • Buffer Compatibility Issues:

    • Challenge: ALPP activity varies significantly with buffer composition

    • Solution: Optimize assay conditions (pH 9.0-10.0, presence of Mg²⁺ and Zn²⁺)

    • Control: Include buffer-only controls to assess background hydrolysis

  • Sample Preparation Variability:

    • Challenge: Membrane-bound vs. soluble ALPP preparation inconsistencies

    • Solution: Standardize sample preparation protocols, including detergent types and concentrations for membrane-bound ALPP

    • Quantification: Normalize activity to protein concentration and include internal standards

  • Calculation of Specific Activity:

    • Standard Formula: Specific Activity (μmol/min/μg) = (ΔRFUs × Calibration Factor) ÷ (Protein amount (μg) × Reaction time (min))

    • Calibration: Establish a standard curve using free 4-MU to convert RFUs to μmol product

What are the most promising research avenues for understanding ALPP's biological functions?

Based on current knowledge gaps and recent findings, the following research directions warrant further investigation:

  • Substrate Identification and Characterization:

    • Apply phosphoproteomic approaches to identify physiological ALPP substrates

    • Determine substrate specificity differences between ALPP and other ALP isozymes

    • Investigate how ALPP-mediated dephosphorylation affects substrate function in different cellular contexts

  • Mechanistic Studies of Immune Modulation:

    • Elucidate the molecular mechanisms underlying ALPP's effects on phagocytosis

    • Investigate how ALPP modulates T cell responses in transplantation models

    • Examine the role of ALPP in modulating specific immune cell signaling pathways

  • Cancer Biology Applications:

    • Characterize the functional role of ALPP in hepatocellular carcinoma progression

    • Investigate mechanisms underlying ALPP-associated increased tumor motility

    • Develop ALPP-targeted therapeutic approaches for cancers with aberrant expression

  • Pregnancy and Placental Biology:

    • Explore ALPP's physiological roles at the maternal-fetal interface

    • Investigate potential immunomodulatory functions during pregnancy

    • Examine ALPP's role in placental development and function

  • Technological Developments:

    • Create selective small molecule inhibitors of ALPP for research applications

    • Develop improved detection methods for ALPP in biological samples

    • Engineer modified ALPP variants with enhanced stability or altered substrate specificity

These research directions would significantly advance our understanding of ALPP biology and potentially reveal novel therapeutic applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.