Recombinant Human Alkylglycerol monooxygenase (AGMO)

Shipped with Ice Packs
In Stock

Description

Enzymatic Activity and Substrate Specificity

AGMO demonstrates strict substrate specificity:

Substrates and Reaction Products

  • Primary substrates:

    1. 1-alkyl-sn-glycerols

    2. Lyso-alkylglycerophosphocholines/ethanolamines

  • Reaction:

    1-alkyl-sn-glycerol+BH₄+O₂fatty aldehyde+glycerol+6,7[8H]-dihydrobiopterin+H₂O[4]1\text{-alkyl-}sn\text{-glycerol} + \text{BH₄} + \text{O₂} \rightarrow \text{fatty aldehyde} + \text{glycerol} + \text{6,7[8H]-dihydrobiopterin} + \text{H₂O}[4]
  • Key limitation: Activity assays historically used cell homogenates rather than purified enzyme preparations, complicating specificity studies .

Lipidomic Impact of AGMO Modulation

In RAW264.7 macrophages:

InterventionObserved EffectSource
AGMO knockdown- 378 lipid species altered (129 overlapping with GCH1 knockdown)
- Accumulation of free alkylglycerols (16–22 carbon chains)
GCH1 knockdown- 176 lipid species altered; tetrahydrobiopterin depletion reduced AGMO activity by 14.2-fold
AGMO overexpression- Increased nitric oxide production in IFN-γ/LPS-stimulated macrophages

Macrophage Polarization Dynamics

  • M1 macrophages (pro-inflammatory): AGMO activity reduced 4.4-fold vs. unpolarized cells .

  • M2 macrophages (anti-inflammatory): AGMO activity increased 1.7-fold .

Clinical and Therapeutic Implications

AGMO’s roles in human pathologies include:

Disease AreaAssociation
Type 2 DiabetesGenetic variants linked to metabolic dysregulation
Neurodevelopmental DisordersAGMO mutations correlate with altered brain lipid profiles
Immune RegulationModulates PAF/lyso-PAF levels and macrophage polarization
CancerEther lipid accumulation influences tumor microenvironment

Challenges and Future Directions

  1. Technical limitations: Current activity assays rely on homogenates rather than pure enzyme .

  2. Therapeutic potential: Recombinant AGMO could enable targeted ether lipid modulation in metabolic or inflammatory disorders .

  3. Unresolved questions:

    • How AGMO regulates cross-talk between diacyl- and alkyl-phospholipids .

    • Mechanistic links between AGMO and nitric oxide signaling in immunity .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributor.
Note: All protein shipments default to standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
AGMO; TMEM195; Alkylglycerol monooxygenase; Transmembrane protein 195
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-445
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
AGMO
Target Protein Sequence
MKNPEAQQDVSVSQGFRMLFYTMKPSETSFQTLEEVPDYVKKATPFFISLMLLELVVSWI LKGKPPGRLDDALTSISAGVLSRLPSLFFRSIELTSYIYIWENYRLFNLPWDSPWTWYSA FLGVDFGYYWFHRMAHEVNIMWAGHQTHHSSEDYNLSTALRQSVLQIYTSWIFYSPLALF IPPSVYAVHLQFNLLYQFWIHTEVINNLGPLELILNTPSHHRVHHGRNRYCIDKNYAGVL IIWDKIFGTFEAENEKVVYGLTHPINTFEPIKVQFHHLFSIWTTFWATPGFFNKFSVIFK GPGWGPGKPRLGLSEEIPEVTGKEVPFSSSSSQLLKIYTVVQFALMLAFYEETFADTAAL SQVTLLLRVCFIILTLTSIGFLLDQRPKAAIMETLRCLMFLMLYRFGHLKPLVPSLSSAF EIVFSICIAFWGVRSMKQLTSHPWK
Uniprot No.

Target Background

Function
Alkylglycerol monooxygenase (AGMO) is a glyceryl-ether monooxygenase that cleaves the O-alkyl bond of ether lipids. Ether lipids are crucial components of brain membranes.
Gene References Into Functions
  1. We identified homozygous and heterozygous mutations of the alkylglycerol monooxygenase (AGMO) gene (MIM 613738) as the likely cause of visceral leishmaniasis relapse in 3 families. PMID: 28586473
  2. An AGMO mutation was discovered in a Saudi family underlying primary microcephaly and intellectual disability. PMID: 27000257
  3. Among all acidic residues within the eight-histidine motif, only mutation of Glu137 to alanine resulted in an 18-fold increase in the Michaelis-Menten constant for tetrahydrobiopterin, suggesting a role in tetrahydrobiopterin interaction PMID: 22220568
  4. Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator) PMID: 20571754
  5. Observational study and genome-wide association study of gene-disease association. (HuGE Navigator) PMID: 20613766
  6. Transmembrane protein 195 exhibits tetrahydrobiopterin-dependent alkylglycerol monooxygenase activity (also known as glyceryl-ether monooxygenase activity, E.C. 1.14.16.5). PMID: 20643956
  7. Observational study of gene-disease association. (HuGE Navigator) PMID: 20419449
  8. Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator) PMID: 20081858

Show More

Hide All

Database Links

HGNC: 33784

OMIM: 613738

KEGG: hsa:392636

STRING: 9606.ENSP00000341662

UniGene: Hs.670634

Protein Families
Sterol desaturase family, TMEM195 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the molecular identity of Alkylglycerol Monooxygenase?

Alkylglycerol monooxygenase (EC 1.14.16.5) was identified as transmembrane protein 195 (TMEM195), a predicted membrane protein with previously unassigned function that occurs in bilateral animals. This sequence assignment was confirmed through multiple experimental approaches, including expression in CHO cells and injection of transmembrane protein 195 cRNA into Xenopus laevis oocytes. AGMO shows no sequence homology to other tetrahydrobiopterin-dependent enzymes like aromatic amino acid hydroxylases or nitric oxide synthases, but contains the fatty acid hydroxylase motif, forming a distinct third group among tetrahydrobiopterin-dependent enzymes .

What is the primary enzymatic function of AGMO?

AGMO is the only enzyme known to cleave the O-alkyl bond of ether lipids without known restrictions to their subclass. It catalyzes the tetrahydrobiopterin-dependent hydroxylation of the α-carbon of the alkyl chain of ether lipids, resulting in an unstable hemiacetal that spontaneously decomposes to an aldehyde and a glycerol derivative. This reaction represents a critical step in the catabolism of ether lipids, which are essential components of brain membranes, protect the eye from cataract, and are required for spermatogenesis .

How can AGMO activity be measured in laboratory settings?

AGMO activity can be measured using a coupled assay system. The standard procedure involves:

  • Incubation of protein extracts with 1-O-pyrenedecyl-sn-glycerol (substrate)

  • Addition of tetrahydrobiopterin, dihydropteridine reductase, catalase, and fatty aldehyde dehydrogenase

  • Addition of cofactors NAD+ and NADPH

  • Incubation for 60 minutes at 37°C

  • Reaction termination with methanol

  • HPLC analysis with fluorescence detection of pyrenedecanoic acid

This coupled assay has a detection limit of 1 nmol/L, making it highly sensitive for AGMO activity determination. It's worth noting that fatty aldehyde dehydrogenase activity is a limiting factor in this assay, and co-expression of fatty aldehyde dehydrogenase can significantly increase the detectable AGMO activity .

What are the challenges in purifying recombinant AGMO protein?

Despite using robust and sensitive assays for AGMO activity, protein purification attempts have consistently failed due to the inherent instability of the enzyme. Researchers attempting to purify AGMO from male rat liver (the source with highest observed activity) encountered significant challenges:

  • The enzyme activity was unstable during purification procedures

  • The protein could not be fully solubilized from membrane fractions

  • Multiple purification steps resulted in progressive loss of activity

This instability necessitated alternative approaches to study AGMO, including recombinant expression in heterologous systems and bioinformatic candidate gene selection strategies. The identification of TMEM195 as AGMO was ultimately achieved through a combination of bioinformatic approaches and functional testing of candidate genes rather than direct protein purification .

What is the physiological significance of AGMO in lipid metabolism?

AGMO plays a critical role in cellular lipid homeostasis through its ability to cleave the O-alkyl bond of ether lipids. Research using shRNA-mediated knockdown of AGMO in RAW264.7 cells demonstrated that modulation of AGMO activity affects a surprisingly high number of lipid species in the cellular lipidome, extending well beyond the direct class of ether lipids. Untargeted lipidomic analysis revealed 1,029 lipid species, of which 378 lipids had significantly altered profiles in AGMO knockdown cells .

The most pronounced fold changes were observed in:

  • Alkylglycerols with alkyl side chains of 16-22 carbon atoms (20-30 fold increase in knockdown cells)

  • Glycosylated ceramides (10-50 fold decrease in knockdown cells)

  • Cardiolipins (10-50 fold decrease in knockdown cells)

These extensive changes in diverse lipid classes suggest that AGMO plays a broader role in lipid homeostasis than previously recognized, potentially through complex regulatory networks involving its tetrahydrobiopterin cofactor .

How does AGMO affect inflammatory processes in macrophages?

AGMO expression and activity demonstrate intriguing regulation patterns in macrophage differentiation:

  • AGMO is up-regulated during differentiation of primary murine bone marrow-derived macrophages to the M2 (anti-inflammatory) phenotype

  • AGMO is down-regulated by inflammatory stimuli resulting in the M1 (pro-inflammatory) phenotype

In RAW264.7 cells, AGMO overexpression enhanced IFN-γ/LPS-mediated nitric oxide formation, while AGMO or GCH1 (an enzyme involved in tetrahydrobiopterin synthesis) knockdown showed the reverse trend. This suggests AGMO might affect IFN-γ/LPS signaling in a proinflammatory manner, creating a complex regulatory network since AGMO itself is downregulated by proinflammatory stimuli .

This complex interplay between AGMO (high in M2 macrophages) and iNOS (high in M1 macrophages), both tetrahydrobiopterin-dependent enzymes, suggests sophisticated regulatory mechanisms in inflammation that remain to be fully elucidated .

How does tetrahydrobiopterin availability impact AGMO function in cellular contexts?

Tetrahydrobiopterin is an absolute requirement for AGMO activity in intact cells. Research using GCH1 knockdown cells (which have depleted tetrahydrobiopterin levels) demonstrated that:

  • Tetrahydrobiopterin depletion in shGCH1 cells resulted in strong accumulation of 1-O-hexadecyl-sn-glycerol, comparable to direct AGMO knockdown

  • This effect could be reversed by supplementation with sepiapterin (SP), which restores tetrahydrobiopterin levels

  • GCH1 knockdown produced changes in the lipidome comparable to direct AGMO knockdown, with 129 of 176 significantly altered lipid species in GCH1 knockdown also significantly changed by AGMO knockdown

These findings establish that intracellular tetrahydrobiopterin is not merely a cofactor but a critical determinant of AGMO activity and consequently of cellular lipid homeostasis. The positive correlation between AGMO knockdown and tetrahydrobiopterin depletion effects on the lipidome demonstrates that tetrahydrobiopterin availability can substantially alter ether lipid metabolism through AGMO .

How can hierarchical clustering analysis inform our understanding of AGMO's impact on the lipidome?

Hierarchical clustering analysis of lipid profile changes in cell lines with manipulated AGMO activity (knockdown and overexpression) revealed eight distinct groups with different response patterns. For example:

  • Group 7 (the largest cluster with 115 lipid species) showed strong accumulation in AGMO knockdown cells (median fold change: 2.9) but remained largely unchanged in AGMO overexpression (median fold change: 0.80)

  • Groups 2 (75 lipid species) and 3 (82 lipid species) showed strong reduction in AGMO knockdown cells (median fold changes: 0.42 and 0.36 respectively)

  • Groups 1 and 8 showed accumulation and depletion, respectively, in AGMO overexpression cells

This clustering approach provides insights into the complex relationships between AGMO activity and various lipid classes, helping to identify patterns that might relate to different metabolic pathways or cellular functions affected by AGMO. Such analysis can guide targeted investigations into specific lipid classes or metabolic pathways most significantly impacted by AGMO activity .

What are the critical considerations for designing experiments to study AGMO function?

When designing experiments to study AGMO function, researchers should consider:

  • Selection of appropriate cell models: RAW264.7 macrophage cells have proven useful due to their relatively high endogenous AGMO expression, making them suitable for both knockdown and overexpression studies.

  • Enzymatic activity measurement: The coupled assay using 1-O-pyrenedecyl-sn-glycerol requires fatty aldehyde dehydrogenase activity, which can be limiting. Co-expression of fatty aldehyde dehydrogenase with AGMO can provide more accurate activity measurements.

  • Comprehensive lipid analysis: Given AGMO's broad impact on the lipidome, untargeted lipidomic approaches are recommended alongside targeted analysis of known AGMO substrates.

  • Tetrahydrobiopterin manipulation: Experiments should control for or manipulate tetrahydrobiopterin levels, as this cofactor critically determines AGMO activity. This can be achieved through GCH1 knockdown and sepiapterin supplementation.

  • Statistical approach: Hierarchical clustering analysis can help identify patterns in complex lipidomic data resulting from AGMO manipulation .

How can researchers address data variability in AGMO experimental studies?

Managing data variability in AGMO studies requires attention to several factors:

  • Control of experimental variables: Standardized experimental procedures, uniform instructions, and control of extraneous stimuli can reduce unsystematic variability.

  • Appropriate statistical analysis: Measures of central tendency (mean, median) should be complemented by measures of variability (standard deviation, variance) to properly assess experimental effects.

  • Sample size and replication: Multiple samples for each condition and repetition of experiments can minimize sampling error.

  • Blind analysis: Data should be analyzed without knowledge of which conditions apply to minimize researcher bias.

  • Quantitative measurements: Whenever possible, use quantitative measurements from scientific instruments rather than qualitative assessments to reduce measurement error.

The sensitivity of statistical tests to detect treatment effects is inversely related to unsystematic variability (random error). Therefore, experimental designs that minimize such variability will provide more robust and reproducible results when studying AGMO function and regulation .

What approaches are recommended for reconciling contradictory findings in AGMO research?

When faced with contradictory findings in AGMO research, consider these approaches:

  • Re-examine experimental conditions: Subtle differences in cell types, differentiation states, or culture conditions can significantly impact AGMO expression and activity.

  • Validate knockdown/overexpression efficiency: Confirm that genetic manipulations resulted in the expected changes at both mRNA and protein levels, and most importantly, at the enzyme activity level.

  • Consider temporal aspects: AGMO regulation may involve feedback mechanisms that create time-dependent effects not captured in single timepoint experiments.

  • Examine substrate specificity: Different ether lipid substrates may be processed with different efficiencies or under different regulatory constraints.

  • Meta-analysis: Combine data from multiple studies to identify patterns and sources of variability across experimental approaches.

For example, while AGMO was initially thought to limit PAF synthesis by metabolizing lyso-PAF, targeted analysis in RAW264.7 cells showed that AGMO knockdown did not affect PAF or lyso-PAF levels. This suggests that intact cells can compensate for altered flux through AGMO by other regulatory mechanisms, highlighting the importance of studying AGMO in integrated cellular systems rather than isolated biochemical reactions .

How do AGMO and GCH1 knockdown affect the lipidome of RAW264.7 cells?

Table 1: Lipidome Changes in AGMO and GCH1 Knockdown Cells

ParameterAGMO KnockdownGCH1 Knockdown
Total lipid species significantly altered378 out of 1,029176 out of 1,029
Overlap between knockdowns129 lipid species129 lipid species
Alkylglycerols20-30 fold increaseSimilar to AGMO knockdown
Glycosylated ceramides10-50 fold decreaseSimilar to AGMO knockdown
Cardiolipins10-50 fold decreaseSimilar to AGMO knockdown
1-O-hexadecyl-sn-glycerolStrong accumulationStrong accumulation, reversible with sepiapterin

This table summarizes the extensive changes in the lipidome caused by either direct AGMO knockdown or indirect reduction of AGMO activity through tetrahydrobiopterin depletion (GCH1 knockdown). The strong correlation between these two approaches confirms that tetrahydrobiopterin availability determines AGMO activity in intact cells .

What are the characteristics of hierarchical clustering in lipid profiles after AGMO manipulation?

Table 2: Hierarchical Clustering of Lipid Profiles After AGMO Manipulation

Cluster GroupNumber of Lipid SpeciesAGMO Knockdown (Median Fold Change)AGMO Overexpression (Median Fold Change)Characteristics
Group 110Minimal change1.5 (25th-75th percentile: 1.4-2.0)Accumulation only in overexpression
Group 2750.42 (25th-75th percentile: 0.089-0.64)Minimal changeStrong reduction in knockdown
Group 3820.36 (25th-75th percentile: 0.19-0.44)Minimal changeStrong reduction in knockdown
Group 71152.9 (25th-75th percentile: 1.9-6.6)0.80 (25th-75th percentile: 0.50-1.1)Strong accumulation in knockdown
Group 827Minimal change0.41 (25th-75th percentile: 0.24-0.53)Depletion in overexpression

This table illustrates the diverse patterns of lipid changes in response to AGMO activity modulation, demonstrating that different lipid classes respond distinctly to AGMO knockdown versus overexpression. These patterns can help identify metabolic pathways directly and indirectly affected by AGMO activity .

What are promising areas for future AGMO research?

Based on current knowledge gaps, several promising research directions emerge:

  • Structural studies: Despite identification of AGMO's sequence, detailed structural information remains lacking. Structural biology approaches could elucidate how AGMO interacts with tetrahydrobiopterin and various ether lipid substrates.

  • Physiological regulation: Further investigation into how AGMO activity is regulated under various physiological and pathological conditions, particularly in relation to inflammatory processes and macrophage polarization.

  • Signaling pathways: Exploration of how AGMO-mediated lipid metabolism interfaces with cellular signaling networks, particularly in brain tissues where ether lipids are abundant.

  • Therapeutic potential: Investigation of AGMO modulation as a potential therapeutic approach for conditions associated with altered ether lipid metabolism, such as certain inflammatory disorders or neurodegenerative diseases.

  • System-level integration: Development of computational models integrating AGMO activity with broader lipid metabolism networks to better understand its role in cellular homeostasis .

What experimental design considerations should guide advanced AGMO research?

Advanced research on AGMO should consider these experimental design elements:

  • In vivo models: Development of tissue-specific or inducible AGMO knockout mice to examine its function in complex physiological contexts.

  • Primary cell cultures: Extension of findings from cell lines to primary cells, particularly primary macrophages with defined polarization states.

  • Temporal dynamics: Time-course experiments to capture the dynamic regulation of AGMO activity and its impact on the lipidome over time.

  • Integration with other omics approaches: Combining lipidomics with transcriptomics and proteomics to develop a systems biology understanding of AGMO function.

  • Translational approaches: Investigation of AGMO expression and activity in human samples from relevant pathological conditions to assess its clinical relevance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.