Recombinant Human Alpha-1D adrenergic receptor (ADRA1D)

Shipped with Ice Packs
In Stock

Description

N-Terminal Domain (NTD)

The alpha-1D NTD is unusually long (95 amino acids) compared to other GPCRs and contains two critical N-glycosylation sites (Asn65 and Asn82) . These modifications are essential for proper receptor folding, trafficking to the plasma membrane, and functional responses to agonists like phenylephrine .

C-Terminal PDZ Ligand

The receptor’s C terminus includes a PDZ-binding motif that interacts with syntrophin and scribble proteins, anchoring it to the plasma membrane and enabling G-protein coupling .

Expression and Localization

FactorEffect on ADRA1DSources
Alpha-1B Co-expressionIncreases surface expression and Ca²⁺ signaling efficacy
Glycosylation DefectsPrevents full-length protein formation; reduces functional responses
PDZ InteractionsRequired for membrane anchoring and signaling

Functional Characteristics

ADRA1D couples to Gq/11 proteins, triggering phospholipase C activation, inositol trisphosphate (IP3) production, and intracellular Ca²⁺ influx .

Ligand Specificity

While most alpha-1 ligands are non-selective, BMY-7378 shows partial selectivity for ADRA1D .

LigandTypeSelectivitySources
BMY-7378Antagonistα1D-selective (partial)
PhenylephrineAgonistNon-selective
CyclazosinAntagonistSlight α1C selectivity

Cardiovascular Studies

ADRA1D knockout mice exhibit hypotension and reduced pressor responses to norepinephrine, highlighting its role in blood pressure regulation .

Therapeutic Targets

Recombinant ADRA1D is used to study:

  1. Vascular Contraction: Critical for understanding hypertension mechanisms .

  2. Cardiac Function: Limited data suggest potential roles in adaptive hypertrophy .

VendorProduct TypeApplicationsSources
CusabioAntibodies, ProteinsIHC, ELISA, functional assays
OrigeneORF ClonesTransfection, protein expression
R&D SystemsLigandsScreening α1D-specific agonists/antagonists

Challenges and Considerations

  1. Low Surface Expression: Without glycosylation (Asn65/Asn82) or alpha-1B co-expression, ADRA1D accumulates intracellularly .

  2. Functional Assays: Dynamic mass redistribution (DMR) assays are preferred for quantifying agonist responses .

  3. Species Variability: Rat/mouse recombinant proteins (e.g., CSB-YP001387RA) differ from human in glycosylation and PDZ interactions .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare the protein according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to settle the contents. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is advisable to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during production. If you have a preferred tag type, please specify it so we can prioritize its development.
Synonyms
ADRA1D; ADRA1A; Alpha-1D adrenergic receptor; Alpha-1A adrenergic receptor; Alpha-1D adrenoreceptor; Alpha-1D adrenoceptor; Alpha-adrenergic receptor 1a
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-572
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MTFRDLLSVSFEGPRPDSSAGGSSAGGGGGSAGGAAPSEGPAVGGVPGGAGGGGGVVGAG SGEDNRSSAGEPGSAGAGGDVNGTAAVGGLVVSAQGVGVGVFLAAFILMAVAGNLLVILS VACNRHLQTVTNYFIVNLAVADLLLSATVLPFSATMEVLGFWAFGRAFCDVWAAVDVLCC TASILSLCTISVDRYVGVRHSLKYPAIMTERKAAAILALLWVVALVVSVGPLLGWKEPVP PDERFCGITEEAGYAVFSSVCSFYLPMAVIVVMYCRVYVVARSTTRSLEAGVKRERGKAS EVVLRIHCRGAATGADGAHGMRSAKGHTFRSSLSVRLLKFSREKKAAKTLAIVVGVFVLC WFPFFFVLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAFLRLLRCQ CRRRRRRRPLWRVYGHHWRASTSGLRQDCAPSSGDAPPGAPLALTALPDPDPEPPGTPEM QAPVASRRKPPSAFREWRLLGPFRRPTTQLRAKVSSLSHKIRAGGAQRAEAACAQRSEVE AVSLGVPHEVAEGATCQAYELADYSNLRETDI
Uniprot No.

Target Background

Function
The alpha-1D adrenergic receptor exerts its effects through the influx of extracellular calcium.
Gene References Into Functions
  1. Hetero-oligomerization of the α1B/D-adrenergic receptor with the chemokine (C-X-C motif) receptor 4:atypical chemokine receptor 3 heteromeric complex is essential for α1B/Dadrenergic receptor function. PMID: 28862946
  2. Processing of the ADRA1D N-terminal domain is a physiological mechanism employed by cells to generate a functional ADRA1D isoform with optimal pharmacodynamic properties. PMID: 27382054
  3. Expression of carboxyl terminus-truncated α1D-adrenoceptors alters ERK and p38 phosphorylation states. PMID: 27146292
  4. Immunoreactivity for ADRA2D was densely distributed in submucosal glands of nasal turbinates. PMID: 26739946
  5. Our findings clarify certain cellular aspects promoted by α1D-AR activity modulation and support a further pharmacological approach in the treatment of hormone-refractory prostate cancer by specifically targeting this AR subtype. PMID: 26621245
  6. This study demonstrated that the ADRA1D gene is involved in neuronal growth and cerebellum development and associated with neurological and psychological disorders. PMID: 26381449
  7. α1A-adrenergic receptors are stably expressed and stimulate cell migration and production of TGF-β1, IGF-1, hyaluronan, and PIP in human skin fibroblasts. PMID: 24844469
  8. Cross-talk between α1D-adrenoceptors and transient receptor potential vanilloid type 1 triggers prostate cancer cell proliferation. PMID: 25481381
  9. Mean α-receptor stain rates in the renal pelvis were 2.65 ± 0.74, 1.35 ± 0.81, and 2.9 ± 0.30 for α1A, 1B, and 1D, respectively. For calyces, the rates were 2.40 ± 0.82, 1.50 ± 0.76, and 2.75 ± 0.44 for α1A, 1B, and 1D, respectively. PMID: 23877383
  10. α(1)(D)-adrenoceptors in the lower urinary tract may play a significant role in the pathophysiology of lower urinary tract disorders. [review] PMID: 23205498
  11. Data indicate that α-dystrobrevin-1 recruits α-catulin, which supersensitizes α(1D)-AR functional responses by recruiting effector molecules to the signalosome. PMID: 21115837
  12. Genetic characteristics associated with response to domperidone therapy included polymorphisms in the drug transporter gene ABCB1, the potassium channel KCNH2 gene, and the α1D-adrenoceptor ADRA1D gene. PMID: 21063774
  13. Data show that activation of α(1)A- or α(1)B-adrenergic receptors inhibits serum-promoted cell proliferation, while α(1)D-AR activation does not exhibit such an inhibitory effect. PMID: 12409310
  14. These studies suggest that gC1qR interacts specifically with α1B- and α1D-, but not α1A-ARs, and this interaction depends on the presence of an intact C-tail. PMID: 14626446
  15. Cell surface expression of α1D-adrenergic receptors is regulated by heterodimerization with α1B-adrenergic receptors. PMID: 14736874
  16. α(1A)- and α(1D)-adrenergic receptors mediate G(1)-S cell-cycle arrest. PMID: 15297446
  17. Human ureter was endowed with each α1 AR subtype, although α1D and α1A ARs were more prevalent than α1B ARs. PMID: 15690361
  18. α1D-adrenergic receptors are regulated by syntrophins through a PDZ domain-mediated interaction. PMID: 16533813
  19. Differential methylation of proximal GC boxes in the ADRA1D promoter disrupts Sp1 binding in a cell-specific manner, resulting in repression of basal α1dAR expression. PMID: 17384146
  20. ADRA1D polymorphisms are predictive markers of the response to β-blockers. PMID: 17404580
  21. Stimulation of α(1D)-ARs by picomolar phenylephrine concentrations, devoid of any contractile vascular effects, induces a proangiogenic phenotype in endothelial cells that is enhanced in a hypoxic environment. PMID: 17660397
  22. In the proximal and medial ureter, the distribution of ARs was α1d ≥ α1a > α1b. In the distal ureter, the distribution of ARs was α1d > α1a > α1b. PMID: 17681068
  23. Expression in the distal ureter was higher than in the proximal and mid ureter, but not statistically significant. PMID: 17973108
  24. Investigate the role of ADRA1D amino residues in binding of β-adrenergic antagonists (prazosin/tamulosin). PMID: 18187928
  25. ADRA1A expression was decreased in end-stage renal disease. Functional receptor changes mediated vascular hypersensitivity to phenylephrine. PMID: 18257748
  26. ADRA1D induces vascular smooth muscle apoptosis via a p53-dependent mechanism. PMID: 18628404
  27. Our data indicate that carboxyl terminus-truncated α(1D)-adrenoceptors are fully functional and subject to regulation by phosphorylation. The roles of the carboxyl termini differ among α(1)-adrenoceptor subtypes. PMID: 19458937

Show More

Hide All

Database Links

HGNC: 280

OMIM: 104219

KEGG: hsa:146

STRING: 9606.ENSP00000368766

UniGene: Hs.557

Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRA1D sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the human alpha-1D adrenergic receptor and what distinguishes it from other adrenergic receptor subtypes?

The alpha-1D adrenergic receptor (ADRA1D) is one of three alpha-1 adrenergic receptor subtypes (alpha-1A, alpha-1B, and alpha-1D) and belongs to the G protein-coupled receptor superfamily. ADRA1D is a transmembrane receptor that signals through the Gq/11 family of G-proteins, leading to the activation of second messenger systems within cells. The receptor plays a crucial role in regulating cardiovascular system function by increasing blood pressure and promoting vascular remodeling. While sharing functional similarities with other alpha-1 subtypes, ADRA1D demonstrates distinctive pharmacological properties and tissue distribution patterns that influence its physiological roles.

The human ADRA1D protein consists of 572 amino acids and shares approximately 98% sequence identity with the rat alpha-1D adrenergic receptor in the transmembrane domains. The gene encoding ADRA1D comprises two exons and a single intron that interrupts the coding region, similar to the alpha-1B-adrenergic receptor gene structure. The receptor's unique structure contributes to its specific ligand binding properties and signaling characteristics that differentiate it from the alpha-1A and alpha-1B subtypes.

How do different cell types express alpha-1 adrenergic receptor subtypes, and what implications does this have for research?

Research using SK-N-MC cells has revealed that native cells can express a heterogeneous mixture of alpha-1 adrenergic receptor subtypes, with varying abundance patterns. Reverse transcription-polymerase chain reaction analysis of mRNA from SK-N-MC cells demonstrated abundant alpha-1a and alpha-1d transcripts but fewer alpha-1b transcripts. This natural heterogeneity creates challenges for studying subtype-specific functions in native systems.

The complex pharmacological properties observed in native cells are directly attributable to the expression of multiple receptor subtypes in different proportions, rather than cell-specific processing or microenvironmental factors. This finding has significant implications for experimental design, suggesting that researchers must account for receptor heterogeneity when studying adrenergic signaling in native cellular systems. The use of inducible expression systems has proven valuable for distinguishing between recombinant and native subtypes, allowing for more controlled experimental conditions.

What expression systems are optimal for studying recombinant human ADRA1D?

For recombinant expression of human ADRA1D, several cell lines have proven effective, each offering distinct advantages depending on research objectives:

Expression SystemAdvantagesConsiderationsApplication
Human Embryonic Kidney 293 cellsNative mammalian post-translational modifications; High transfection efficiencyBackground expression of other adrenergic receptors possibleBinding studies; Functional assays
SK-N-MC cellsWell-characterized for alpha-1 receptor expression; Suitable for comparative studiesEndogenous expression of multiple alpha-1 subtypesPharmacological characterization; Comparative analysis
Inducible expression systemsControlled expression levels; Allows direct comparison with native receptorsRequires optimization of inducer concentrationSelective expression of specific subtypes

The choice of expression system should be guided by specific research questions. For example, HEK293 cells effectively express ADRA1D with proper binding properties similar to the rat ortholog, allowing for detailed pharmacological characterization. SK-N-MC cells with isopropyl-beta-D-thiogalactoside-inducible vectors have successfully been used to express all three human alpha-1 receptor subtypes, enabling comparative studies of their pharmacological properties.

What methodologies are effective for characterizing ADRA1D-mediated signaling pathways?

Characterizing ADRA1D-mediated signaling requires multiple complementary approaches:

  • Inositol Phosphate Formation Assay: ADRA1D activation by agonists such as norepinephrine leads to increased inositol phosphate formation. This pathway can be quantified using radiolabeled inositol incorporation followed by ion-exchange chromatography separation of inositol phosphates. This methodology provides a direct measure of Gq/11-coupled receptor activation.

  • Intracellular Calcium Mobilization: ADRA1D activation mobilizes intracellular calcium, which can be measured using fluorescent calcium indicators (e.g., Fura-2, Fluo-4) and real-time fluorescence imaging or plate reader assays. This approach allows for temporal resolution of signaling events and can detect subtle differences in receptor activation kinetics between subtypes.

  • G-protein Coupling Assays: GTPγS binding assays can be employed to directly measure G-protein activation following ADRA1D stimulation, providing insights into coupling efficiency and selectivity among G-protein subtypes.

  • Mitogenic Response Measurement: Since ADRA1D activates mitogenic responses and regulates cellular growth and proliferation, assays measuring DNA synthesis (e.g., BrdU incorporation), cell cycle progression, and cell proliferation rates are valuable for characterizing longer-term signaling outcomes.

How can researchers distinguish ADRA1D from other alpha-1 receptor subtypes using selective ligands?

Distinguishing between alpha-1 receptor subtypes is crucial for subtype-specific research. Several compounds demonstrate differential binding affinities that can be exploited for subtype identification:

CompoundRelative Affinity for ADRA1DComparison to Other SubtypesApplication
(+)-NiguldipineLow100-fold more potent at alpha-1A than at alpha-1B or alpha-1DSelective for distinguishing alpha-1A from alpha-1D
5-MethylurapidilModerateSimilar potency at alpha-1A and alpha-1D; 10-fold lower at alpha-1BLimited use for alpha-1A/D discrimination; useful for alpha-1B distinction
BMY 7378HighSelective alpha-1D antagonistPreferential for alpha-1D identification
Prazosin hydrochlorideHighNon-selective alpha-1 antagonistGeneral alpha-1 receptor identification
TamsulosinModerateRoughly equal affinity for alpha-1A and alpha-1DLimited discrimination between alpha-1A/D

Inhibition binding studies with these compounds can reveal receptor heterogeneity in native tissues. For example, in uninduced SK-N-MC cells, inhibition curves for (+)-niguldipine and 5-methylurapidil fit best to a two-site model, indicating significant receptor heterogeneity. Upon induction of specific recombinant subtypes, the pharmacological profile shifts, often resulting in inhibition curves that fit better to a one-site model.

What functional assays best demonstrate the pharmacological specificity of ADRA1D?

To establish the pharmacological specificity of ADRA1D, several functional assays have proven particularly informative:

  • Agonist-Induced Response Measurement: Evaluating the potency and efficacy of agonists like norepinephrine, phenylephrine, and cirazoline in activating downstream signaling pathways provides a functional pharmacological profile. Comparing EC50 values and maximum responses across receptor subtypes reveals functional selectivity patterns.

  • Antagonist Inhibition Studies: Determining the potency of antagonists in blocking agonist-induced responses allows for calculation of pA2 values and Schild slopes, which can indicate competitive versus non-competitive antagonism. This approach is particularly useful with subtype-selective antagonists like BMY 7378 for ADRA1D.

  • Receptor Desensitization and Internalization: Alpha-1 receptor subtypes differ in their desensitization and internalization kinetics. Measuring these parameters following agonist exposure provides another dimension for subtype differentiation, often revealing unique regulatory mechanisms for ADRA1D.

  • G-protein Subtype Coupling Specificity: While all alpha-1 subtypes couple primarily to Gq/11, subtle differences in coupling efficiency and potential coupling to other G-protein families may exist. Assays using G-protein inhibitors or siRNA knockdown approaches can reveal ADRA1D-specific coupling preferences.

How do receptor heterogeneity and expression patterns influence experimental design and data interpretation?

The complex pharmacology observed in native systems often stems from the co-expression of multiple receptor subtypes. In SK-N-MC cells, the pharmacological profile reflecting both alpha-1A and alpha-1B properties results from the expression of all three subtypes in different proportions. This heterogeneity presents significant challenges for experimental design and data interpretation.

Researchers should consider several approaches to address receptor heterogeneity:

What are the current challenges in studying ADRA1D-specific signaling in physiological contexts?

Despite advances in receptor characterization, several challenges remain in studying ADRA1D-specific signaling in physiologically relevant contexts:

  • Lack of Highly Selective Ligands: While compounds like BMY 7378 show preference for ADRA1D, truly subtype-selective ligands remain limited. Many alpha-1 receptor ligands are non-selective for receptor subtypes, complicating the interpretation of pharmacological studies in native tissues.

  • Variable Expression Levels: The relative expression levels of alpha-1 receptor subtypes vary across tissues and can be altered under pathophysiological conditions, creating moving targets for research.

  • Receptor Crosstalk: ADRA1D can functionally interact with other receptors and signaling systems, creating complex signaling networks that are difficult to dissect with traditional pharmacological approaches.

  • Cell-Type Specific Signaling: The same receptor can couple to different downstream pathways depending on the cellular context, necessitating studies in relevant native cell types rather than recombinant systems alone.

  • Temporal Dynamics: ADRA1D signaling exhibits complex temporal patterns, with rapid desensitization and internalization followed by recycling or degradation, requiring time-resolved experimental approaches.

How can CRISPR/Cas9 gene editing advance our understanding of ADRA1D function?

CRISPR/Cas9 technology offers powerful approaches for studying ADRA1D function with unprecedented precision:

  • Endogenous Receptor Tagging: Adding fluorescent or epitope tags to the endogenous ADRA1D gene allows visualization and immunoprecipitation of the receptor at physiological expression levels, avoiding artifacts associated with overexpression.

  • Subtype-Specific Knockout Models: Generating cell lines or animal models with selective knockout of ADRA1D while preserving other alpha-1 subtypes enables clean attribution of phenotypes to specific receptor subtypes.

  • Single Nucleotide Modifications: Introducing specific mutations associated with altered receptor function or disease states permits detailed structure-function analyses and disease modeling.

  • Regulatory Element Editing: Modifying promoter or enhancer regions controlling ADRA1D expression can reveal mechanisms of developmental and tissue-specific expression regulation.

  • Signaling Domain Swapping: Creating chimeric receptors by swapping signaling domains between alpha-1 subtypes can identify regions responsible for subtype-specific signaling properties.

What biophysical techniques provide insights into ADRA1D structure-function relationships?

Advanced biophysical approaches are increasingly valuable for understanding ADRA1D structure and dynamics:

  • Cryo-Electron Microscopy: This technique can potentially resolve the three-dimensional structure of ADRA1D in different conformational states, revealing mechanisms of ligand binding and receptor activation.

  • Resonance Energy Transfer Approaches: FRET and BRET techniques allow real-time monitoring of receptor conformational changes, dimerization, and interactions with signaling partners in living cells.

  • Single-Molecule Microscopy: Techniques such as total internal reflection fluorescence (TIRF) microscopy can track individual ADRA1D molecules in the membrane, revealing dynamic behaviors invisible to ensemble measurements.

  • Hydrogen-Deuterium Exchange Mass Spectrometry: This approach can map ligand-induced conformational changes in ADRA1D, identifying regions involved in signal transduction.

  • Molecular Dynamics Simulations: Computational approaches can predict ADRA1D behavior in different membrane environments and with various ligands, generating testable hypotheses about structure-function relationships.

How can researchers address common challenges in recombinant ADRA1D expression?

Several strategies can help overcome common challenges in achieving reliable expression of functional ADRA1D:

  • Optimizing Codon Usage: Human ADRA1D contains 572 amino acids, and optimizing codon usage for the expression system can significantly improve protein yields.

  • Signal Sequence Modification: Adding or optimizing signal sequences can enhance receptor trafficking to the plasma membrane.

  • Expression Vector Selection: Using vectors with strong, cell-type appropriate promoters and enhancers can increase expression levels. Inducible systems, as demonstrated with isopropyl-beta-D-thiogalactoside-inducible vectors in SK-N-MC cells, provide additional control over expression timing and levels.

  • Post-Translational Modification Considerations: Ensuring the expression system supports appropriate glycosylation and other modifications is crucial for receptor function.

  • Fusion Tags: Strategic placement of epitope or purification tags can facilitate detection and purification while minimizing interference with receptor function.

  • Temperature Modulation: Lowering the culture temperature during expression can sometimes improve folding of complex membrane proteins.

What controls are essential for validating ADRA1D functional assays?

Robust validation of ADRA1D functional assays requires multiple controls:

  • Pharmacological Controls:

    • Positive controls: Known potent agonists (e.g., norepinephrine, phenylephrine)

    • Negative controls: Non-ligands or vehicle-only treatments

    • Selective antagonists: Pre-treatment with BMY 7378 should block ADRA1D-specific responses

    • Pan-antagonists: Prazosin should block all alpha-1 receptor-mediated responses

  • Expression Controls:

    • Quantification of receptor expression levels via binding assays

    • Comparison of wild-type versus mutant (non-functional) ADRA1D

    • Inducible systems to compare induced versus uninduced states

  • Pathway Controls:

    • G-protein inhibitors to confirm coupling mechanism

    • Phospholipase C inhibitors to verify canonical signaling pathway

    • Calcium chelators to confirm calcium dependency of responses

  • System Controls:

    • Parental versus transfected cells to identify background responses

    • Selective knockdown of ADRA1D to confirm specificity

    • Comparison across multiple cell types to assess system-specific effects

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.