Recombinant Human Alpha-2B adrenergic receptor (ADRA2B)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Alpha-2B Adrenergic Receptor (ADRA2B)

The alpha-2B adrenergic receptor (ADRA2B) is a G-protein-coupled receptor (GPCR) that regulates neurotransmitter release and vascular tone. It belongs to the α₂-adrenergic receptor family, which includes three subtypes: α₂A, α₂B, and α₂C. ADRA2B is encoded by the intronless gene ADRA2B (GenBank: NM_000682) and is expressed in various tissues, including the central nervous system and vascular smooth muscle . Recombinant ADRA2B refers to the engineered production of this receptor in heterologous systems (e.g., HEK293 cells or insect cells) for research and therapeutic applications.

Agonists and Antagonists

CompoundTypeTargetEffectSource
EtomidateAgonistα₂B-ARIncreases blood pressure (cardiovascular stability)
BAY-6096Antagonistα₂B-ARReduces α₂B-mediated vasoconstriction (reperfusion injury)
ReboxetineAgonistα₂B-ARModulates emotional memory (variant-dependent)

BAY-6096 demonstrates high selectivity for α₂B (IC₅₀ = 14 nM) and reversibly inhibits receptor activity, making it a tool for studying microvascular dysfunction in ischemia-reperfusion models .

Key Polymorphisms

VariantEffect on ReceptorClinical Association
Del301-303Reduced GRK-mediated phosphorylationLower basal metabolic rate in obesity, emotional memory bias
Gly394Gly (C+1182A)No functional changeNo association with hypertension

The Del301-303 variant is more prevalent in Caucasians (allele frequency: 0.31) than African Americans (0.12) . While it correlates with obesity, it shows no significant association with blood pressure regulation in large cohorts .

Research Applications of Recombinant ADRA2B

Recombinant ADRA2B is used in:

  • Functional Assays: Studying receptor-ligand interactions, desensitization kinetics, and signaling pathways .

  • Antibody Development: Monoclonal antibodies (e.g., Clone 491613) enable precise receptor localization and expression analysis .

  • Pharmacological Screening: Identifying subtype-selective ligands for therapeutic targeting .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: All protein shipments default to standard blue ice packs. If you require dry ice shipping, please communicate this in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ADRA2B; ADRA2L1; ADRA2RL1; Alpha-2B adrenergic receptor; Alpha-2 adrenergic receptor subtype C2; Alpha-2B adrenoreceptor; Alpha-2B adrenoceptor; Alpha-2BAR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-450
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MDHQDPYSVQATAAIAAAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADIL VATLIIPFSLANELLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEY NSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASSIGS FFAPCLIMILVYLRIYLIAKRSNRRGPRAKGGPGQGESKQPRPDHGGALASAKLPALASV ASAREVNGHSKSTGEKEEGETPEDTGTRALPPSWAALPNSGQGQKEGVCGASPEDEAEEE EEEEEEEEECEPQAVPVSPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRR AQLTREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPKHCKVPHGLFQFFFWIGYCNSS LNPVIYTIFNQDFRRAFRRILCRPWTQTAW
Uniprot No.

Target Background

Function
Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase through the action of G proteins. The order of potency for agonists of this receptor is clonidine > norepinephrine > epinephrine = oxymetazoline > dopamine > p-tyramine = phenylephrine > serotonin > p-synephrine / p-octopamine. For antagonists, the order of potency is yohimbine > chlorpromazine > phentolamine > mianserine > spiperone > prazosin > alprenolol > propanolol > pindolol.
Gene References Into Functions
  1. An exaggerated vasoconstriction response to dexmedetomidine, an alpha-2 adrenergic agonist, has been associated with deletion in the alpha-2B adrenoreceptor gene (ADRA2B deletion). PMID: 28482761
  2. Research indicates an association between arterial stiffness and platelet alpha2B-Rs gene expression. PMID: 28923554
  3. Full-length alpha2B-AR interacts with GGA2 but not GGA1, and its third intracellular loop was found to directly interact with both GGA1 and GGA2. Further mapping of interaction domains revealed that the GGA1 hinge region and the GGA2 GAE domain bound to multiple subdomains of the loop. PMID: 27901063
  4. The ADRA2B DD genotype was associated with Hypertension and was more prevalent in the indigenous population of Mountain Shoria (Siberia). PMID: 29039833
  5. Stress administered immediately before learning selectively enhanced long-term recall in ADRA2B deletion carriers. Stress applied 30min before learning impaired recognition memory in male deletion carriers, while enhancing recognition memory in female deletion carriers. PMID: 28254464
  6. This study demonstrated that a deletion variant of the ADRA2B gene encoding the alpha2b-adrenoceptor reduces the stress-induced shift from hippocampal cognitive toward dorsal striatal habit memory. PMID: 28115477
  7. These results identify a beta2-adrenergic-Ca(2+)-actin axis as a new regulator of cell deformability. PMID: 27875276
  8. ADRA2B SNPs were associated with myocardial infarction susceptibility, blood pressure, and plasma lipids. PMID: 28456594
  9. These findings suggest that deletion variants of ADRA2B may exhibit greater levels of cognitive-affective flexibility compared to non-carriers. PMID: 26899992
  10. The role of GGA3 in the cell surface export of alpha2B-adrenergic receptor PMID: 26811329
  11. Common polymorphisms in the ADRA2B gene are not associated with orthostatic hypotension risk in Chinese populations. PMID: 26427149
  12. Norepinephrine-related neurogenetic differences enhance the subjective vividness of perceptual experience and its emotional enhancement. PMID: 25904801
  13. The results of this study indicated that ADRA2B is closely related to individual differences in human attention orientation but not to individual differences in emotional processing. PMID: 25325286
  14. ADRA2B deletion carriers showed decreased neural activity in the amygdala when recognizing emotional faces under control conditions and increased amygdala activity under stress. PMID: 25127926
  15. The ADRA2B deletion variant may selectively predict stress effects on memory in females. PMID: 24997351
  16. Polymorphism DD of the ADRA2B gene is a genetic predictor of predisposition to the blockade of the right and left bundle branch block. PMID: 25558682
  17. Carrying the ADRA2B deletion variant enhances the relationship between arousal at encoding and subsequent memory for moderately arousing events. PMID: 24149058
  18. ADRA2B mutations are associated with emotional subjectivity of visual perception. PMID: 24058067
  19. The ADRA2b deletion variant, previously associated with vasoconstriction, is linked to emotional memory and visual perception. PMID: 24269973
  20. A mutation in alpha2B-adrenergic receptor is associated with autosomal dominant cortical myoclonus and epilepsy. PMID: 24114805
  21. Carriers of the ADRA2B functional deletion variant showed impaired recognition and slower retrieval of neutral faces under stress. PMID: 23583499
  22. Statistically significant prevalence of the homozygous genotype DD of the ADRA2B gene was found in patients with atrioventricular blocks and sick sinus node syndrome. PMID: 24087960
  23. This study demonstrated for the first time an independent contribution of the ADRA2B genetic polymorphism to memory impairment and further suggests a possible protective role of the deletion variant against disease development. PMID: 23499426
  24. Adenosine alpha2B receptor is upregulated in the peripheral blood leukocytes of multiple sclerosis patients. PMID: 23225885
  25. Molecular dynamics simulations of palmitoylated/glycosylated, membrane-integrated human A(2B)AR in its native environment is a possible approach, and this model can be used for designing potent and selective A(2B)AR antagonists. PMID: 22570080
  26. There were no main effects or interactions observed in relation to the ADRA2B genotype. PMID: 21965191
  27. A significant novel finding from this study is that the affective modulation of T2 detection is influenced by a non-additive (epistatic) interaction between the ADRA2B and 5-HTTLPR insertion/deletion polymorphisms. PMID: 21854681
  28. Adenosine A(2B) receptor signaling plays a role in regulating placental 11beta-hydroxysteroid dehydrogenase type 2 expression, consequently impacting fetal development. PMID: 22701600
  29. Activation of the adenosine A(2B) receptor protects against vascular injury while simultaneously enhancing plaque stability as indicated by increased collagen content. PMID: 22743060
  30. A triple arg motif mediates alpha(2B)-adrenergic receptor interaction with Sec24C/D and export PMID: 22404651
  31. For the first time, we revealed on clinical - genetic material an association between hereditary disturbances of cardiac conduction and polymorphism of the 2-adrenergic receptor gene. PMID: 22839581
  32. This study found significant effects of ADRA2B haplotype polymorphisms on response inhibition in a large Chinese sample, with the minor AAGG haplotype associated with shorter SSR. PMID: 22218095
  33. Data strongly demonstrate that the small GTPase ARF1 modulates ERK1/2 activation by alpha(2B)-AR and provide the first evidence indicating a novel function for ARF1 in regulating the MAPK signaling pathway. PMID: 22025613
  34. The ADRA2B polymorphism influences emotional memory formation but not memory retrieval in the amygdala and left inferior frontal gyrus. PMID: 21259387
  35. The noradrenaline-mediated depolarization of vascular smooth muscle cells is produced by activation of both alpha(1)-and alpha(2)-adrenoceptors. PMID: 20739228
  36. Polymorphisms of ADRA2B were detected in patients with atrial fibrillation. PMID: 21942960
  37. ADRA2B gene polymorphism might be associated with hereditary sick sinus node syndrome. PMID: 21878072
  38. Data do not show any association between the presence of the alpha2B-adrenergic receptor deletion allele and the occurrence of spontaneous abortions. PMID: 21159032
  39. Alpha2B-adrenergic receptor interaction with tubulin controls its transport from the endoplasmic reticulum to the cell surface PMID: 21357695
  40. Gene x exercise interactions were observed for A2BGlu9/12 and B2Gln27Glu on change in lean soft tissue (LST, p = 0.02); exercisers with the A2BGlu9- background gained LST compared to a loss among controls over 12 months (p\0.05) PMID: 20401689
  41. Homozygosity for the insertion [I]/deletion allele of alpha(2B)-AR gene polymorphism is associated with silent myocardial ischemia in type 2 diabetes mellitus patients with coronary artery disease. PMID: 20692245
  42. The findings of this study do not support a functional significance of the ADRA2B indel polymorphism at position -4825 relative to the start codon in the far upstream region of the promoter in the present migraine subjects. PMID: 20651814
  43. Data provide strong evidence indicating that Rab8 GTPase interacts with distinct motifs in the C termini of alpha(2B)-AR and beta(2)-AR and differentially modulates their traffic from the TGN to the cell surface. PMID: 20424170
  44. Carriage of the ADRA2B deletion abolished the relative memory impairment in homozygous COMT val158 carriers compared to met158 carriers. PMID: 20110158
  45. The ADRA2B 301-303 deletion allele (ins/del and del/del, n = 18) was associated with resistance to desensitization. PMID: 20051907
  46. Middle-aged white men carrying the DD genotype of the alpha(2B)-AR have a significantly increased risk for sudden cardiac death and myocardial infarction, especially before the age of 55 years. PMID: 12535806
  47. No major functional significance of the alpha(2B) adrenergic receptor polymorphism was found in the present sample of morbidly obese subjects. PMID: 12822042
  48. A polymorphism in the (alpha)2B adrenoceptor gene associates with hypertension. PMID: 14744925
  49. Body fat response to exercise training in older adults is associated with the combined effects of the Glu12/Glu9 alpha2b-adrenergic receptor, Trp64Arg beta3-adrenergic receptor, and Gln27Glu beta2-adrenergic receptor gene variants PMID: 15166301
  50. The 12Glu9 polymorphism of ADRA2B is associated with impaired insulin secretion and may predict the development of Type 2 diabetes. PMID: 15309292

Show More

Hide All

Database Links

HGNC: 282

OMIM: 104260

KEGG: hsa:151

STRING: 9606.ENSP00000387281

UniGene: Hs.247686

Involvement In Disease
Epilepsy, familial adult myoclonic, 2 (FAME2)
Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRA2B sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of the human ADRA2B receptor?

ADRA2B belongs to the G-protein coupled receptor 1 family and specifically to the adrenergic receptor subfamily. Unlike some other adrenergic receptors, ADRA2B has structural distinctions including a notable region containing 12 consecutive glutamic acid residues in its third intracellular loop. The receptor consists of 450 amino acids and lacks consensus sequences for N-linked glycosylation in its amino terminus or extracellular loops, making it structurally distinctive among adrenergic receptors . The receptor maintains the typical seven-transmembrane domain structure characteristic of G-protein coupled receptors, with intracellular and extracellular loops that mediate signaling functions.

How does ADRA2B differ structurally from other adrenergic receptors?

While ADRA2B shares homology with other human alpha-2-adrenergic receptor subtypes, it has several distinguishing features. Most notably, it contains a distinctive sequence of 12 consecutive glutamic acid residues in its third intracellular loop, a feature not present in other adrenergic receptor subtypes . Additionally, ADRA2B lacks N-linked glycosylation sites in its extracellular domains, which differentiates it from other members of the adrenergic receptor family such as the beta-2 adrenergic receptor. These structural differences may contribute to its specific pharmacological properties and signaling characteristics.

What are the primary signaling pathways associated with ADRA2B?

ADRA2B primarily functions through interaction with G-proteins to mediate intracellular signaling. When activated, ADRA2B couples to G-proteins, leading to inhibition of adenylyl cyclase and reduced cAMP production. Pharmacological studies using guanine nucleotide analogs (like 5'-guanylylimidodiphosphate) demonstrate the receptor's functional coupling to G-proteins, as evidenced by rightward shifts in agonist competition curves . This signaling pathway influences various cellular processes, including neurotransmitter release, ion channel activity, and gene expression. The receptor's unique structural features, particularly the glutamic acid-rich region, may influence its G-protein coupling efficiency and downstream signaling dynamics.

What expression systems are most effective for producing recombinant ADRA2B?

For successful expression of recombinant ADRA2B, mammalian cell systems have demonstrated high efficacy. Mouse fibroblast Ltk- cells have been successfully employed for stable transfection of human ADRA2B DNA, resulting in functional receptor expression suitable for pharmacological characterization . This system allows for proper protein folding and membrane insertion necessary for G-protein coupled receptors. While the search results don't specifically mention other expression systems for ADRA2B, researchers working with similar G-protein coupled receptors often employ HEK293 or CHO cell lines. For structural studies requiring higher protein yields, insect cell expression systems using baculovirus vectors might be considered, though optimization would be necessary to maintain receptor functionality.

What are the recommended protocols for pharmacological characterization of ADRA2B?

Effective pharmacological characterization of ADRA2B typically involves radioligand binding assays using selective antagonists such as [³H]rauwolscine. In previous studies, [³H]rauwolscine demonstrated high-affinity binding (Kd = 0.33 nM) with saturable characteristics (Bmax = 1.4 pmol/mg of protein) when used with recombinant ADRA2B . Competition binding assays with various ligands establish pharmacological profiles, with studies showing a rank order potency of yohimbine > prazosin > oxymetazoline for ADRA2B . Functional coupling to G-proteins can be assessed by examining the effects of guanine nucleotides (e.g., 100 μM 5'-guanylylimidodiphosphate) on agonist competition curves, where rightward shifts indicate successful G-protein interaction . These methodologies enable comprehensive characterization of receptor binding properties and signaling capabilities.

How can single subject experimental designs be applied to ADRA2B research?

When investigating ADRA2B's effects on cognitive or behavioral outcomes, single subject experimental designs offer several advantages. These designs allow individuals to serve as their own controls, which is particularly valuable when examining genetic variants like ADRA2B deletions that may have subject-specific effects on memory and emotional processing . Multiple baseline designs across participants or conditions can be employed to establish experimental control when studying ADRA2B's influence on behavioral measures without requiring withdrawal of interventions . When applying these designs to ADRA2B research, it's essential to focus on prediction (hypothesized outcomes), verification (demonstrating baseline consistency), and replication (showing similar results across multiple phases) . For studies examining ADRA2B's effects on emotional memory, alternating treatment designs might be appropriate to compare different emotional stimuli processing under controlled conditions.

How does the ADRA2B deletion variant affect emotional memory processing?

The ADRA2B deletion variant significantly influences emotional memory processing, with complex effects that vary across studies. Research indicates that ADRA2B deletion carriers demonstrate enhanced memory for emotional information compared to neutral information . Some studies report a bias toward negative information in carriers , while others show more general emotional enhancement effects with sensitivity to both positive and negative stimuli . In older adults specifically, ADRA2B deletion carriers have shown preferential memory for positive words over negative and neutral words, even when these were pronounced with negative prosody . This suggests age-specific modulation of the ADRA2B variant's effects. The mechanisms likely involve altered noradrenergic signaling, which influences amygdala activity during encoding of emotional stimuli, as demonstrated by increased neural activity in the amygdala of ADRA2B carriers during affective image encoding .

How does aging interact with ADRA2B variant effects on memory?

Aging significantly modulates how the ADRA2B deletion variant influences memory processing. In older adults, ADRA2B carriers typically demonstrate a "positivity effect," preferentially remembering positive information over negative or neutral material . This pattern differs from the more general emotional enhancement or negative bias sometimes observed in younger ADRA2B carriers. The age-dependent effect may relate to changes in the noradrenergic system that occur with aging, as studies have noted increased noradrenergic activity in older adults that may contribute to persistent focus on affective information, particularly in ADRA2B carriers . Furthermore, the noradrenergic system plays a crucial role in cognitive-affective flexibility and cognitive reserve, which becomes increasingly important during aging . Consequently, older ADRA2B carriers may benefit from enhanced emotional regulation capabilities. This age-dependent modulation becomes even more pronounced when combined with other genetic variants such as CB1 deletions, suggesting complex interactions between genetic factors and aging processes in emotional memory .

What experimental paradigms best capture ADRA2B's influence on memory?

To effectively assess ADRA2B's impact on memory processes, verbal operation span-like tasks incorporating affective content have proven particularly valuable. In studies examining ADRA2B variant effects, researchers have successfully employed paradigms where participants process positive, negative, and neutral words under varying cognitive load conditions . This approach allows for measurement of both maintenance and manipulation of emotional information in working memory. For optimal experimental design when studying ADRA2B variants, researchers should consider: (1) including both emotional and neutral stimuli to detect differential effects, (2) manipulating cognitive load to reveal genotype effects that may only emerge under challenging conditions, (3) controlling for age as ADRA2B effects differ between younger and older populations, and (4) incorporating neuroimaging measures focused on amygdala activation to connect behavioral outcomes with neural mechanisms . Additionally, longitudinal designs may help elucidate how ADRA2B's effects on emotional memory processing evolve across the lifespan.

How might ADRA2B pharmacological profiles be leveraged for therapeutic development?

The distinct pharmacological profile of ADRA2B presents opportunities for targeted therapeutic development. ADRA2B shows specific binding characteristics with a rank order potency of yohimbine > prazosin > oxymetazoline , which differs from other adrenergic receptor subtypes. This unique profile could enable the development of subtype-selective compounds that target ADRA2B while minimizing off-target effects. Given ADRA2B's established role in emotional memory processing and its association with cognitive flexibility , compounds targeting this receptor might have applications in conditions characterized by emotional dysregulation or cognitive inflexibility. The interaction between ADRA2B signaling and the endocannabinoid system, as suggested by the synergistic effects of ADRA2B and CB1 variants , also points to potential multi-target therapeutic approaches. Future drug development efforts might explore compounds that modulate both systems simultaneously or that target specific downstream pathways affected by ADRA2B activation.

Comparison of Memory Performance Across ADRA2B and CB1 Genotypes

Note: Data derived from study with 207 older adults performing verbal operation span-like tasks

What measurement techniques provide the most reliable quantification of ADRA2B receptor expression?

For accurate quantification of ADRA2B receptor expression, radioligand binding assays using selective ligands such as [³H]rauwolscine have demonstrated high reliability. In previous characterization studies, these assays revealed specific binding parameters (Kd = 0.33 nM, Bmax = 1.4 pmol/mg of protein) for the recombinant receptor . For researchers studying ADRA2B expression, it's important to note that receptor density may vary across tissues and can be influenced by regulatory mechanisms. While the search results don't provide comparative data on alternative quantification methods, complementary approaches like RT-qPCR for mRNA quantification and Western blotting with receptor-specific antibodies could provide additional dimensions of expression data. For functional assessment, measuring downstream signaling events (such as cAMP levels or ERK phosphorylation) following receptor stimulation can complement direct binding measurements to provide a more complete picture of functional receptor expression.

How might advanced genetic approaches further elucidate ADRA2B's role in cognitive processing?

Future research could benefit from advanced genetic approaches including genome-wide association studies (GWAS) that examine ADRA2B in concert with other genetic variants affecting cognitive processing. The discovery that combined ADRA2B and CB1 deletions produce synergistic effects on emotional memory suggests that haplotype analyses examining multiple genetic variants may reveal more complex patterns than single polymorphism studies. Techniques such as CRISPR-Cas9 gene editing in cellular and animal models could help establish causal relationships between specific ADRA2B structural features (like the distinctive glutamic acid repeat region) and functional outcomes. Additionally, epigenetic studies examining how environmental factors might modify ADRA2B expression could help explain individual differences in cognitive responses not accounted for by genetic variation alone. These approaches would move beyond simple genotype-phenotype associations toward understanding the complex regulatory networks influencing ADRA2B's role in cognitive processing.

What unexplored interactions between ADRA2B and other neurotransmitter systems warrant investigation?

While research has identified interactions between ADRA2B and the endocannabinoid system through CB1 receptor variants , several other potential interactions remain underexplored. Given ADRA2B's role in emotional memory processing, interactions with serotonergic systems (particularly 5-HT1A receptors, which were used as probes in ADRA2B isolation ) merit investigation. The dopaminergic system, crucial for reward processing and working memory, may interact with ADRA2B signaling to influence emotional valence effects on memory. Additionally, interactions with the cholinergic system, which plays critical roles in attention and memory encoding, might explain some of ADRA2B's cognitive effects. Research combining pharmacological challenges of these neurotransmitter systems in individuals with different ADRA2B genotypes could reveal mechanistic insights. Understanding these interactions could lead to more targeted approaches for conditions involving emotional dysregulation and cognitive impairment, potentially revealing new multi-target therapeutic strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.