Recombinant Human Alpha-2C adrenergic receptor (ADRA2C)

Shipped with Ice Packs
In Stock

Description

Ligand Interactions and Pharmacology

ADRA2C interacts with diverse agonists and antagonists, enabling precise modulation of its activity.

Agonists

CompoundSelectivityApplications
(R)-3-Nitrobiphenylineα2C-selectiveResearch ligand
ClonidineNon-selective α2-AR agonistHypertension treatment
DexmedetomidineHigh α2 selectivitySedation, analgesia
Brimonidineα2A > α2CGlaucoma management

Antagonists

CompoundSelectivityApplications
Yohimbineα2C > α2A/α2BAnxiety, erectile dysfunction
JP-1302α2C-selectiveResearch tool
BrexpiprazoleAtypical antipsychoticDepression, schizophrenia
QuetiapineBroad GPCR antagonistBipolar disorder, sleep aid

Data compiled from .

Research Applications and Methodologies

Recombinant ADRA2C is widely used to study receptor signaling, ligand binding, and therapeutic potential.

Assay Systems

  • Fluorometric Ca²⁺ assays: Co-expression with chimeric Gα(qi5) or Gα16 proteins enables indirect measurement of ADRA2C activation via Gq-mediated Ca²⁺ mobilization .

  • cAMP inhibition: Forskolin-stimulated cAMP accumulation assays quantify receptor-mediated Gαi/o signaling .

  • High-throughput screening: Plate-reader-based systems optimize ligand discovery .

Genetic and Functional Insights

  • Del322-325 variant: A 12-nucleotide deletion in the third intracellular loop (frequency: 44% in African Americans vs. 3.5% in Caucasians) reduces agonist binding and G-protein coupling .

  • Ortholog studies: Mouse ADRA2C knockouts exhibit cardiac hypertrophy and altered locomotor responses to amphetamines .

Challenges in Production and Study

  • Sequence variability: Frameshift errors in early database entries (e.g., AAA35513.1) necessitate careful validation of recombinant constructs .

  • Low expression efficiency: Intronless genes may require optimized expression systems (e.g., mammalian HEK293 cells) .

  • Cross-reactivity: α2C shares ~70% homology with α2A/α2B, complicating subtype-specific ligand development .

Clinical and Therapeutic Relevance

ADRA2C’s role in CNS and cardiovascular regulation positions it as a target for:

  • Psychiatric disorders: Antipsychotics (e.g., risperidone, quetiapine) modulate ADRA2C-mediated neurotransmission .

  • Pain management: Agonists may reduce nociceptive signaling via spinal or supraspinal pathways .

  • Hypertension: Variants like Del322-325 may influence responsiveness to α2-AR agonists .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes and we will fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, kindly consult your local distributor.
Note: All protein shipments are standardly accompanied by blue ice packs. For dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms exhibit a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ADRA2C; ADRA2L2; ADRA2RL2; Alpha-2C adrenergic receptor; Alpha-2 adrenergic receptor subtype C4; Alpha-2C adrenoreceptor; Alpha-2C adrenoceptor; Alpha-2CAR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-462
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MASPALAAALAVAAAAGPNASGAGERGSGGVANASGASWGPPRGQYSAGAVAGLAAVVGF LIVFTVVGNVLVVIAVLTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMAYWYFG QVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIVAVWLISA VISFPPLVSLYRQPDGAAYPQCGLNDETWYILSSCIGSFFAPCLIMGLVYARIYRVAKLR TRTLSEKRAPVGPDGASPTTENGLGAAAGAGENGHCAPPPADVEPDESSAAAERRRRRGA LRRGGRRRAGAEGGAGGADGQGAGPGAAESGALTASRSPGPGGRLSRASSRSVEFFLSRR RRARSSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREACQVPGPLFK FFFWIGYCNSSLNPVIYTVFNQDFRRSFKHILFRRRRRGFRQ
Uniprot No.

Target Background

Function
Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase through the action of G proteins.
Gene References Into Functions
  1. The frequency of alpha2CDel322-325-AR in suicide and non-suicide victims was similar. Genotype frequencies for the alpha2CDel322-325-AR polymorphism in depressed and schizophrenic subjects were higher than in controls, but these differences did not reach statistical significance. These findings suggest that alpha2CDel322-325-AR might play a role in the pathophysiology of opiate abuse and dependence. PMID: 27007576
  2. Immunoreactivity for ADRA2C was densely distributed in vascular smooth muscle of nasal turbinates. PMID: 26739946
  3. ADRA2c is associated with heart rate recovery after exercise. PMID: 26058836
  4. Common polymorphisms in the ADRA2C gene are not associated with orthostatic hypotension risk in Chinese. PMID: 26427149
  5. Adrenergic receptor genotype influences heart failure severity and beta-blocker response in children with dilated cardiomyopathy. PMID: 25406899
  6. alpha2C-adrenoreceptor interaction with filamin-2 PMID: 25110951
  7. Genetic variants of ADRA2C do not alter intracellular localization or plasma membrane trafficking. PMID: 24643471
  8. the ADRA2C 322-325I/D genotype is a novel genetic risk marker for SBI among individuals with hyperhomocysteinemia. PMID: 24676565
  9. the region comprising the N-terminal half of The receptors contributed to the alpha2C-selectivity of drug binding. PMID: 23868076
  10. Bucindolol prevents ventricular arrhythmias in subjects with heart failure and reduced left ventricular ejection fractions, and this effect is modulated by adrenergic alpha 2 receptor polymorphisms. PMID: 23275278
  11. the predicted signal peptide in the N-terminal tail of the alpha(2C)-adrenoceptor does not act as a cleavable signal peptide PMID: 22503931
  12. there is little evidence for an association between alpha(2C)Del322-325 polymorphism and an increased prevalence of left ventricular hypertrophy in patients with systemic hypertension. PMID: 22040172
  13. Genotype polymorphism frequencies for B1 receptor (amino acid positions 389 and 49) and alpha 2c receptor (deletion 322-325) are not significantly different in SC patients compared to female controls. PMID: 19167638
  14. The alpha(2C)-Del322-325 polymorphism does not exhibit reduced signalling to adenylyl cyclase and may not represent a clinically important phenotype. PMID: 20128806
  15. The common ADRA2C variant affected pain perception before and after dexmedetomidine but did not affect other cognitive responses PMID: 19423370
  16. the norepinephrine lowering and clinical therapeutic responses to bucindolol were strongly influenced by alpha(2C) receptor genotype PMID: 19880803
  17. Increased expression of alpha(2C)-adrenoceptors may contribute to enhanced cold-induced vasoconstriction and Raynaud's phenomenon. PMID: 15345481
  18. ADRA2C had one haplotype block of 10 kb PMID: 15592690
  19. alpha2CDel322-325 polymorphism is associated with increased sympathetic nervous and adrenomedullary hormonal activities, both during supine rest and during pharmacologically evoked catecholamine release PMID: 15861038
  20. A genetic variant of the alpha 2C-adrenoceptor subtype--resulting from the deletion of four consecutive amino acids at codons 322-325--confers a change in brain function playing a role in the pathogenesis of major depressive disorder. PMID: 16407897
  21. Genetic variations of the alpha and beta adrenergic receptors (alpha 2C Del322-325 allele) were found to be significant predictors of vasospastic angina PMID: 16569551
  22. alpha(2)-ARs might contribute neurotrophic actions in vivo synergistically or in permutation with other neurotrophic factors PMID: 17192578
  23. The ADRA2C deletion polymorphism had no effect on markers of resting sympathetic activity and cardiovascular measures, and did not account for ethnic differences in blood pressure. PMID: 17351367
  24. An estrogen-dependent increase in expression of cold-sensitive alpha(2C)-ARs may contribute to the increased activity of cold-induced vasoconstriction under estrogen-replete conditions PMID: 17644575
  25. Homozygosity for the alpha 2C Del322-325 polymorphism is not associated with heart failure in black South Africans PMID: 18320080
  26. Because the alpha(2C)-adrenoceptor distribution pattern is conserved between rodents and humans, studies on the role of the alpha(2C)-adrenoceptor in rodent models of neuropsychiatric disorders may be relevant also for human diseases. PMID: 18435421
  27. Cyclic AMP acts through Rap1 and JNK signaling to increase expression of cutaneous smooth muscle alpha2C-adrenoceptors. PMID: 18487435
  28. Genetic variants in the alpha2C-adrenoceptor and G-protein contribute to ethnic differences in cardiovascular stress responses PMID: 18698227
  29. Genotype and haplotype of ADRA2C did not significantly affect survival in metoprolol-treated or carvedilol-treated heart failure patients. PMID: 18702968
  30. Beta1- and alpha2c-adrenoreceptor variants as predictors of clinical aspects of dilated cardiomyopathy in people of African ancestry. PMID: 18776959
  31. Our findings provide important evidence that the ADRA2C polymorphism is involved in the etiology of ADHD in Korean subjects. PMID: 18835330
  32. Three polymorphisms in ADRA2C and five polymorphisms in ADRB1 were involved in eight cross-validated epistatic interactions identifying several two-locus genotype classes with significant relative risks of death/transplant in heart failure patients PMID: 18947427
  33. The ADRA2C del322-325 variant did not affect vascular sensitivity to local cold exposure. PMID: 19444546

Show More

Hide All

Database Links

HGNC: 283

OMIM: 104250

KEGG: hsa:152

STRING: 9606.ENSP00000386069

UniGene: Hs.123022

Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRA2C sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Alpha-2C adrenergic receptor and what distinguishes it from other alpha-2 adrenergic receptor subtypes?

The Alpha-2C adrenergic receptor (α2C adrenoceptor) is one of three highly homologous subtypes of alpha-2 adrenergic receptors (α2A, α2B, and α2C). These receptors play critical roles in regulating neurotransmitter release from sympathetic nerves and from adrenergic neurons in the central nervous system. The primary functional distinction between α2C and other subtypes lies in their activation parameters and physiological roles. Studies in mice have demonstrated that while the α2A subtype inhibits neurotransmitter release at high stimulation frequencies, the α2C subtype specifically modulates neurotransmission at lower levels of nerve activity . This functional specialization makes α2C particularly important for basal neurotransmitter tone regulation rather than during intense stimulation.

Additionally, the α2C subtype shows distinctive pharmacological properties, with unique profiles of selective agonists and antagonists that differentiate it from α2A and α2B subtypes .

What is the genetic structure of the ADRA2C gene and how does it differ from other adrenergic receptor genes?

The human ADRA2C gene has a unique genomic structure among adrenergic receptors as it contains no introns in either its coding or untranslated sequences . This lack of introns is unusual among G-protein coupled receptors and has implications for gene regulation mechanisms. The absence of introns means that ADRA2C gene expression is not regulated through alternative splicing, which distinguishes it from many other receptor genes. This characteristic also affects experimental approaches when studying its transcriptional regulation and expression patterns.

For accurate quantification of ADRA2C gene expression, researchers typically employ qPCR using reference genes such as GAPDH and RPS13 (in human studies) or Gapdh and Rps29 (in rodent studies), with relative quantification using the ΔΔCt method: ΔΔCt = (Ct(target gene)sample – Ct(reference gene)sample) – (Ct(target gene)reference sample – Ct(reference gene)reference sample), with relative mRNA calculated as 2^-ΔΔCt .

What expression systems are most effective for producing recombinant human ADRA2C for research purposes?

CHO-K1 cells have proven to be particularly effective host cells for recombinant human ADRA2C expression. These cells provide appropriate post-translational modifications and membrane trafficking for the receptor while maintaining stable expression levels. The receptors expressed in CHO-K1 cells demonstrate appropriate pharmacological properties and G-protein coupling (primarily to Gi/Go proteins) .

When generating stable cell lines expressing ADRA2C, researchers should consider the following parameters:

ParameterSpecificationNotes
Host Cell LineCHO-K1Provides appropriate post-translational modifications
G-Protein CouplingGi/GoEssential for proper signal transduction
Typical Protein Yield~5 μg/μLFor membrane preparations
Buffer Composition50 mM Tris-HCL (pH 7.4), 0.5mM EDTA, 10mM MgCl2, 10% sucroseMaintains receptor stability
Validation MethodBinding assaysTo confirm receptor functionality

Alternative expression systems include HEK293 cells, though these may demonstrate different coupling efficiencies or post-translational modifications that could affect receptor pharmacology.

What are the critical considerations when designing binding assays for ADRA2C?

When designing binding assays for ADRA2C, several methodological considerations are crucial:

  • Membrane Preparation: Use fresh or properly stored frozen membrane preparations from cells expressing recombinant ADRA2C. Typical concentrations are 5 μg protein per assay unit .

  • Radioligand Selection: Choose radioligands with appropriate affinity and selectivity for α2C receptors. Saturation binding assays should be performed to determine receptor concentration (Bmax) and affinity (Kd).

  • Competition Assays: Include known reference agonists and antagonists to determine affinity (Ki) values and validate receptor functionality.

  • Buffer Composition: Typically 50 mM Tris-HCL (pH 7.4), 0.5mM EDTA, 10mM MgCl2 with 10% sucrose to maintain receptor stability .

  • Incubation Conditions: Temperature and duration must be optimized to achieve equilibrium binding while minimizing receptor degradation.

  • Data Analysis: Use appropriate pharmacological models (one-site, two-site binding) for accurate interpretation of binding curves.

For functional assays, GTPγS binding can be particularly informative for Gi-coupled receptors like ADRA2C to assess ligand efficacy beyond mere binding affinity.

What selective ligands exist for ADRA2C and how is their selectivity quantified?

Several pharmacological agents show selectivity for the α2C adrenergic receptor:

Selective Agonists:

  • (R)-3-Nitrobiphenyline (though it also shows weak antagonist activity at α2A and α2B)

Selective Antagonists:

  • JP-1302: Demonstrates selectivity for α2C over α2A and α2B subtypes

  • Yohimbine derivatives 9 and 10: Show >43-fold selectivity over α2A, α2B, and α1 subtypes

  • ORM-10921: Potent and selective α2C-AR antagonist with demonstrated in vitro efficacy

Selectivity is typically quantified through comparative binding assays, determining binding affinity (Ki values) or functional potency (EC50/IC50 values) across multiple receptor subtypes. The selectivity ratio is calculated as the ratio of Ki values between the target receptor (α2C) and other receptor subtypes (α2A, α2B). For therapeutic development, a selectivity ratio of at least 10-fold is generally considered minimum, while ratios >100-fold are preferred for research tool compounds.

Recent evidence indicates that using dopamine as an agonist in binding studies may enhance the apparent potency and selectivity ratios of α2C-AR selective antagonists like ORM-10921, highlighting the importance of agonist selection in binding studies .

How does dopamine interact with ADRA2C and what are the implications for experimental design?

Dopamine has been identified as an activating ligand for striatal α2C-ARs, with evidence suggesting significant cross-talk between dopaminergic and adrenergic systems through this receptor. This has several important implications for experimental design:

  • Ligand Selection: When studying α2C-AR pharmacology, particularly in dopamine-rich brain regions like the striatum, researchers should consider dopamine as a potential endogenous ligand in addition to noradrenaline.

  • Enhanced Selectivity: Studies have shown that α2C-AR selective antagonists, such as ORM-10921, demonstrate increased in vitro potency and selectivity ratios when dopamine, rather than a traditional adrenergic agonist, is used as the activating ligand .

  • Dopamine Metabolism: Changes in α2C-AR activity directly affect dopamine metabolism. α2C-AR knockout mice show decreased homovanillic acid (HVA, a dopamine metabolite) in the striatum, while α2C-AR overexpression mice show increased HVA in the frontal cortex .

  • Extracellular Dopamine Levels: Selective α2C-AR antagonists like ORM-10921 increase extracellular dopamine levels in the prefrontal cortex of rats, suggesting a regulatory role for α2C-AR in dopaminergic neurotransmission .

These findings indicate that researchers studying α2C-AR should carefully consider the dopaminergic environment of their experimental system and potentially incorporate dopamine measurements in their studies.

How does ADRA2C modulate neurotransmitter release in the central nervous system?

ADRA2C plays a distinctive role in modulating neurotransmitter release with specific temporal and concentration-dependent characteristics:

  • Frequency-Dependent Modulation: While α2A-AR inhibits neurotransmitter release primarily at high stimulation frequencies, α2C-AR is specialized for modulating neurotransmission at lower levels of nerve activity . This frequency-dependent specialization suggests that α2C-AR is more important for tonic regulation of neurotransmitter release under basal conditions.

  • Concentration-Dependent Effects: α2C-AR is responsible for inhibiting noradrenaline (NA) release at low endogenous NA concentrations (10–100 nM), whereas α2A-AR inhibits NA release at higher concentrations (0.1–10 μM) . This indicates differential sensitivity to neurotransmitter levels.

  • Kinetics of Inhibition: α2C-AR-mediated inhibition of NA release is a slower process than α2A-AR-mediated inhibition, though the potency and affinity of NA is actually higher at the α2C-AR than at the α2A-AR .

  • Neurotransmitter Synthesis Regulation: α2C-AR also influences neurotransmitter synthesis by modulating tyrosine hydroxylase activity, thereby affecting the conversion of tyrosine to DOPA (the dopamine precursor) in the hippocampus and cerebral cortex .

This complex regulatory profile means that α2C-AR has a unique neuromodulatory role distinct from other adrenergic receptor subtypes, and experimental designs need to account for these specific characteristics.

What are the effects of ADRA2C knockout or overexpression on neurotransmitter systems?

Genetic manipulation studies of α2C-AR provide valuable insights into its role in neurotransmitter regulation:

In α2C-AR Knockout (KO) Mice:

  • Decreased homovanillic acid (HVA) concentrations in the striatum, indicating reduced striatal dopamine turnover

  • Disinhibition of α2-AR agonist-induced inhibition of striatal GABA release

  • Potential inhibition of striatal acetylcholine release

  • Reduced plasma corticosterone and antidepressant-like behaviors

In α2C-AR Overexpression (OE) Mice:

  • Increased HVA concentrations in the frontal cortex, suggesting enhanced cortical dopamine turnover

  • Elevated plasma corticosterone levels

  • Depressive-like behavioral phenotypes

In Non-Transgenic Animals Treated with α2C-AR Antagonists:

  • Increased extracellular dopamine levels in the frontal cortex

  • When combined with D2 receptor antagonists, α2C-AR antagonism increases brain-derived neurotrophic factor (BDNF) in striatal tissue

  • Improved sensorimotor gating, enhanced cognition, and antipsychotic-like behavioral effects

These findings suggest a complex role for α2C-AR in regulating multiple neurotransmitter systems, with region-specific effects on dopaminergic, GABAergic, and cholinergic transmission, as well as significant impacts on stress response systems and behavior.

What evidence links ADRA2C to neuropsychiatric disorders and what are the therapeutic implications?

Multiple lines of evidence link α2C-AR to neuropsychiatric disorders:

  • Schizophrenia: Studies have found altered α2-adrenoceptor density in the dorsolateral prefrontal cortex (DLPFC) of antipsychotic-treated schizophrenia subjects . This alteration may be due to transcriptional activation and could be regulated by epigenetic mechanisms such as histone posttranslational modifications (PTMs).

  • Dopamine Dysregulation: α2C-AR plays a significant role in regulating dopamine release and metabolism, particularly in the striatum and prefrontal cortex . The mesolimbic-cortical dopamine imbalance characteristic of schizophrenia may be modulated by α2C-AR activity.

  • Cognitive Function: Animal studies show that selective α2C-AR antagonism improves cognition and sensorimotor gating , functions that are often impaired in schizophrenia and other neuropsychiatric disorders.

  • Depression: α2C-AR knockout mice exhibit antidepressant-like behaviors, while overexpression leads to depressive phenotypes , suggesting involvement in mood regulation.

Therapeutic implications include:

  • Selective α2C-AR antagonists like ORM-10921 show promise for addressing both psychotic and depressive symptoms

  • Combined targeting of D2 receptors and α2C-AR may offer advantages over current antipsychotic approaches

  • α2C-AR modulation could help address cognitive deficits associated with neuropsychiatric disorders

  • Region-specific effects on neurotransmission suggest potential for targeted symptom management with fewer side effects than current therapies

What methodologies are most effective for studying ADRA2C expression in clinical samples?

For studying ADRA2C expression in clinical samples, several methodological approaches have proven effective:

When comparing between studies, researchers should be attentive to data normalization methods, as different approaches (TPM vs. FPKM) can affect interpretation of expression differences.

How can gene expression and epigenetic modification studies enhance our understanding of ADRA2C regulation?

Gene expression and epigenetic studies provide crucial insights into ADRA2C regulation:

  • Transcriptional Regulation: Studies analyzing ADRA2C mRNA expression in different tissues and disease states have revealed tissue-specific regulatory mechanisms. For example, research in schizophrenia has identified altered ADRA2C expression in the dorsolateral prefrontal cortex (DLPFC) .

  • Histone Modifications: Analysis of permissive and repressive histone posttranslational modifications (PTMs) at ADRA2C gene promoter regions can reveal epigenetic mechanisms controlling expression. These modifications provide a dynamic layer of gene regulation that may be altered in disease states .

  • Methodological Approach:

    • ChIP-seq (Chromatin Immunoprecipitation sequencing) to identify specific histone modifications at the ADRA2C locus

    • ATAC-seq (Assay for Transposase-Accessible Chromatin sequencing) to assess chromatin accessibility

    • DNA methylation analysis of the ADRA2C promoter region

    • Integration of expression data with epigenetic profiles to develop comprehensive regulatory models

  • Comparative Analysis: Analyzing ADRA2C expression across different clinical stages or disease conditions can identify regulatory changes associated with disease progression. For instance, pan-cancer analysis has utilized RNA-seq data from TCGA and GTEx databases to understand ADRA2C expression patterns across cancer types .

When implementing these approaches, researchers should ensure proper normalization of gene expression data using validated reference genes and apply appropriate statistical analyses, such as one-way ANOVA for comparing expression across different clinical stages .

What computational approaches are most effective for predicting novel ADRA2C-ligand interactions?

Several computational approaches have proven effective for predicting ADRA2C-ligand interactions:

  • Homology Modeling: Since crystal structures of human α2C-AR are not yet available, homology modeling based on related GPCRs provides structural templates for virtual screening. Models should incorporate the unique pharmacological properties of α2C-AR that distinguish it from α2A and α2B subtypes.

  • Molecular Docking: Structure-based virtual screening through molecular docking can identify potential ligands from large compound libraries. For α2C-AR, docking protocols should account for the receptor's demonstrated ability to bind both traditional adrenergic ligands and dopamine .

  • Pharmacophore Modeling: Developing pharmacophore models based on known selective ligands such as (R)-3-Nitrobiphenyline, JP-1302, and ORM-10921 can guide the design of novel selective compounds.

  • Machine Learning Approaches: Quantitative structure-activity relationship (QSAR) models and other machine learning techniques can predict binding affinity and selectivity based on training sets of known ligands.

  • Molecular Dynamics Simulations: To account for receptor flexibility and ligand binding kinetics, molecular dynamics simulations provide insights into the dynamic nature of ADRA2C-ligand interactions.

  • Allosteric Site Prediction: Computational methods to identify potential allosteric binding sites may be particularly valuable for developing highly selective modulators, as allosteric sites tend to be less conserved across receptor subtypes.

When implementing these approaches, researchers should validate computational predictions with experimental binding assays, ideally using both traditional adrenergic agonists and dopamine as activating ligands to capture the full spectrum of ADRA2C pharmacology .

How can researchers address the challenges of receptor subtype selectivity in ADRA2C studies?

Achieving and confirming receptor subtype selectivity in ADRA2C studies presents several challenges. Researchers can address these through:

  • Comparative Binding Assays: Perform parallel binding studies with all three α2-AR subtypes (α2A, α2B, α2C) to establish selectivity profiles. Calculate selectivity ratios (Ki at non-target receptors / Ki at α2C) to quantify selectivity.

  • Use of Multiple Selective Tools: Combine pharmacological approaches (selective antagonists like JP-1302 or ORM-10921 ) with genetic approaches (siRNA knockdown, CRISPR-Cas9 editing) to confirm receptor subtype involvement.

  • Testing Multiple Agonists: Evidence suggests that using dopamine as an agonist can enhance the apparent potency and selectivity of α2C-AR antagonists . Consider testing both traditional adrenergic agonists and dopamine in binding/functional assays.

  • Knockout/Knockdown Controls: Include α2C-AR knockout or knockdown controls to confirm specificity of observed effects.

  • Tissue Selection: Choose experimental tissues or cell systems where α2C-AR expression predominates over other α2-AR subtypes. The striatum has high α2C-AR expression relative to other subtypes .

  • Functional Readouts: Select functional assays that highlight α2C-AR's unique characteristics, such as modulation of neurotransmission at low stimulation frequencies or effects on dopamine metabolism .

  • Cross-Validation: Confirm findings using multiple methodological approaches to rule out artifacts or non-specific effects.

By implementing these strategies, researchers can enhance confidence in the specificity of observed effects to the α2C-AR subtype.

What are the most significant unresolved questions in ADRA2C research and how might they be addressed?

Several significant unresolved questions remain in ADRA2C research:

  • Dopamine-ADRA2C Interaction Mechanisms:

    • Question: What is the precise molecular mechanism by which dopamine activates α2C-AR?

    • Approach: Structural biology techniques (cryo-EM, X-ray crystallography) of α2C-AR with dopamine, combined with site-directed mutagenesis to identify binding determinants.

  • Region-Specific Functions:

    • Question: How do the functions of α2C-AR differ across brain regions?

    • Approach: Region-specific conditional knockout models, combined with in vivo microdialysis and electrophysiology.

  • Therapeutic Translation:

    • Question: Can selective α2C-AR modulators provide therapeutic benefit in neuropsychiatric disorders with fewer side effects than current treatments?

    • Approach: Clinical trials with highly selective α2C-AR antagonists, focusing on cognitive and negative symptoms in schizophrenia or treatment-resistant depression.

  • Epigenetic Regulation:

    • Question: How is ADRA2C expression epigenetically regulated in health and disease?

    • Approach: Comprehensive epigenomic profiling (histone modifications, DNA methylation) of the ADRA2C locus in relevant tissues and disease models.

  • Cancer Relevance:

    • Question: What is the functional significance of ADRA2C expression changes in cancer?

    • Approach: CRISPR-mediated manipulation of ADRA2C expression in cancer cell lines, followed by phenotypic characterization and signalome analysis.

  • Interactions with Other Neurotransmitter Systems:

    • Question: Beyond dopamine and noradrenaline, how does α2C-AR interact with other neurotransmitter systems (glutamatergic, serotonergic)?

    • Approach: Multimodal in vivo microdialysis combined with selective pharmacological tools.

Addressing these questions will require integrative approaches combining molecular, cellular, systems, and behavioral neuroscience techniques, potentially leading to new therapeutic strategies for neuropsychiatric and potentially oncological conditions.

How might emerging technologies advance our understanding of ADRA2C biology?

Several emerging technologies offer promising avenues for advancing ADRA2C research:

  • Cryo-EM and Advanced Structural Biology: Determining high-resolution structures of ADRA2C in different conformational states and with various ligands would provide unprecedented insights into its function and ligand selectivity mechanisms.

  • Single-Cell Transcriptomics: This technology can reveal cell type-specific expression patterns of ADRA2C across brain regions and in disease states, potentially identifying specialized neuronal populations where ADRA2C plays critical roles.

  • CRISPR-Cas9 Gene Editing: Beyond simple knockouts, precise editing of ADRA2C regulatory elements or coding sequences can help decipher structure-function relationships and regulatory mechanisms.

  • Optogenetics and Chemogenetics: These approaches allow temporal and spatial control of ADRA2C-expressing neurons, enabling dissection of circuit-level functions in behavior and disease.

  • In Vivo Biosensors: Development of fluorescent or bioluminescent sensors for ADRA2C activation would permit real-time visualization of receptor activity in living tissues.

  • Artificial Intelligence for Drug Discovery: Advanced AI algorithms could accelerate the discovery of novel selective ADRA2C ligands by learning from existing pharmacological data and predicting new chemical scaffolds.

  • Spatial Transcriptomics: This technology preserves spatial information while profiling gene expression, potentially revealing regional specialization of ADRA2C function within complex tissues.

  • Organoids and Advanced Tissue Models: Brain organoids with defined ADRA2C genetic modifications could serve as more physiologically relevant models than traditional cell lines for studying receptor function.

These technologies, particularly when used in combination, hold promise for resolving longstanding questions about ADRA2C biology and accelerating therapeutic development targeting this receptor.

What interdisciplinary approaches might yield new insights into ADRA2C function?

Interdisciplinary approaches have significant potential to advance ADRA2C research:

  • Computational Neuroscience and Systems Biology: Integration of molecular data with circuit-level models could reveal how ADRA2C modulation affects network dynamics in health and disease. This approach could clarify how receptor-level properties translate to behavioral phenotypes.

  • Pharmacogenomics and Precision Medicine: Analyzing how genetic variants in ADRA2C affect drug responses could guide personalized therapeutic approaches in psychiatric disorders, potentially identifying patient subgroups most likely to benefit from ADRA2C-targeted interventions.

  • Neuroimmunology: Investigating potential interactions between ADRA2C and immune function in the CNS might uncover novel roles in neuroinflammatory processes relevant to psychiatric and neurodegenerative disorders.

  • Developmental Neurobiology: Examining ADRA2C expression and function across developmental stages could reveal critical periods when receptor modulation might have particularly profound effects on brain circuitry formation.

  • Chronobiology: Exploring how ADRA2C function varies with circadian rhythms might provide insights into its role in sleep-wake regulation and mood disorders with strong circadian components.

  • Behavioral Economics and Computational Psychiatry: Integrating ADRA2C pharmacology with computational models of decision-making could clarify its role in reward processing and addiction behaviors.

  • Clinical Informatics: Mining electronic health records to identify associations between ADRA2C polymorphisms, disease manifestations, and treatment outcomes could generate novel hypotheses for targeted investigation.

By crossing traditional disciplinary boundaries, these approaches can provide multifaceted perspectives on ADRA2C function that might not emerge from conventional research paradigms.

What practical recommendations can be made for researchers beginning work with recombinant ADRA2C?

Researchers beginning work with recombinant ADRA2C should consider these practical recommendations:

  • Expression System Selection: CHO-K1 cells have been validated for stable expression of functional human ADRA2C with appropriate G-protein coupling (Gi/Go) . When establishing a new expression system, validate receptor functionality through both binding and signaling assays.

  • Membrane Preparation Protocol: Optimize membrane preparation protocols to achieve consistent protein yield (typically ~5 μg/μL) and receptor stability. A buffer composition of 50 mM Tris-HCL (pH 7.4), 0.5mM EDTA, 10mM MgCl2, 10% sucrose has proven effective .

  • Pharmacological Validation: Before proceeding with experimental studies, validate your receptor preparation using established ligands with known pharmacological properties. Include both agonists like (R)-3-Nitrobiphenyline and antagonists like JP-1302 .

  • Subtype Selectivity Controls: Always include controls to confirm subtype selectivity, especially when working with novel compounds. Test against all three alpha-2 receptor subtypes when possible.

  • Consider Dopamine Interactions: Given evidence that dopamine can function as an activating ligand for ADRA2C , consider including dopamine-based assays in your experimental design, particularly when working with striatal or dopamine-rich preparations.

  • Gene Expression Quantification: For gene expression studies, use validated reference genes (GAPDH and RPS13 for human; Gapdh and Rps29 for rodent) and the ΔΔCt method for relative quantification .

  • Data Normalization and Reporting: When analyzing expression data, clearly document normalization methods (log2 transformation of TPM or FPKM values is standard practice) and ensure statistical approaches are appropriate for your experimental design.

  • Translational Relevance: Consider the potential therapeutic implications of your findings, particularly in relation to neuropsychiatric disorders where ADRA2C modulation shows promise .

These recommendations should help establish reliable experimental systems and generate reproducible, translationally relevant data in ADRA2C research.

How can researchers effectively integrate findings across different experimental modalities in ADRA2C research?

Effective integration of findings across experimental modalities requires systematic approaches:

  • Hierarchical Integration Framework: Adopt a framework that connects molecular/cellular findings (receptor binding, signaling) to systems-level effects (neurotransmitter release, neural circuit activity) and ultimately to behavioral/clinical outcomes. This structural approach helps identify gaps and inconsistencies across levels of analysis.

  • Consistent Pharmacological Tools: When possible, use the same pharmacological agents across in vitro, ex vivo, and in vivo studies to facilitate direct comparisons. Selective agents like JP-1302 or ORM-10921 can serve as common tools across experimental platforms.

  • Translational Biomarkers: Identify biomarkers that can be measured across species and experimental systems. For ADRA2C, measures of dopamine metabolism (such as HVA levels) or patterns of neurotransmitter release can serve this purpose.

  • Computational Modeling: Develop computational models that can integrate diverse data types and predict how receptor-level changes might manifest across biological scales. For example, models connecting ADRA2C modulation to dopamine release dynamics and ultimately to behavioral outputs.

  • Systematic Review Methodology: Apply systematic review and meta-analysis techniques to your own research program, formally comparing results across different experimental approaches and identifying factors that might explain disparities.

  • Multi-Modal Data Collection: When possible, collect multiple data types from the same experimental subjects or preparations. For example, combining electrophysiology with microdialysis, or behavioral testing with subsequent tissue analysis.

  • Data Sharing and Standardization: Adopt standardized data formats and openly share datasets to enable cross-laboratory comparisons and meta-analyses.

  • Collaborative Networks: Establish collaborations with researchers using complementary approaches to facilitate integrative studies that no single laboratory could accomplish independently.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.