Recombinant Human Androgen-dependent TFPI-regulating protein (ADTRP)

Shipped with Ice Packs
In Stock

Description

Discovery and Identification of ADTRP

ADTRP was first described by Lupu and colleagues in 2011 as a novel protein encoded by the previously uncharacterized gene C6ORF105 . The identification process employed a sophisticated data mining approach of NCBI's GEO microarray datasets, which revealed strong coexpression between Tissue Factor Pathway Inhibitor (TFPI) and C6ORF105 . This discovery was significant as researchers were seeking to identify mechanisms that regulate the natural expression of TFPI, the major inhibitor of tissue factor-factor VIIa (TF-FVIIa)–dependent FXa generation, due to its relevance in preventing vascular disease.

The researchers employed a global meta-analysis (GAMMA) of microarray datasets to identify genes consistently coexpressed with TFPI across heterogeneous conditions. Statistical analysis demonstrated a significant positive correlation between TFPI and C6ORF105 expression (Pearson's r: 0.636; r²: 0.405) . Based on its regulatory relationship with TFPI and its responsiveness to androgens, the protein was named Androgen-dependent TFPI-regulating protein (ADTRP) .

Molecular Structure

According to UniProtKB/Swiss-Prot data, ADTRP is likely to have two isoforms with molecular weights of approximately 27-29 kDa and contains 3-6 predicted transmembrane domains . Sequence analysis indicates that ADTRP belongs to the androgen-inducible gene (AIG) family, sharing homology with AIG1 cloned from human dermal papilla cells .

The protein contains potential palmitoylation sites at Cys7 and Cys62/79, which play a crucial role in its localization to lipid rafts and caveolae in the cell membrane . This membrane localization is essential for ADTRP's function, as demonstrated by experiments with palmitoylation-deficient mutants that showed decreased partition in the detergent fraction after Triton X-114 extraction, reduced cell surface clustering, and increased cytoplasmic localization .

Cellular Localization

ADTRP predominantly localizes to the plasma membrane of endothelial cells, where it colocalizes with both TFPI and caveolin-1 . Immunofluorescence microscopy and biochemical assays have confirmed that ADTRP partially resides in caveolae/lipid rafts, similar to TFPI . The clustering of ADTRP together with TFPI during live cell incubation with Cholera Toxin, a specific ligand for the lipid raft marker GM1, suggests their shared localization in cell membrane lipid rafts .

Regulation of TFPI Expression and Activity

One of the primary functions of ADTRP is the regulation of TFPI expression and activity in endothelial cells. ADTRP controls TFPI at multiple levels, including mRNA expression, cellular distribution, and cell-associated anticoagulant activity .

Post-transcriptional silencing experiments demonstrated that down-regulation of ADTRP in endothelial cells results in:

  • Reduction of TFPI mRNA expression

  • Decrease in cell surface TFPI antigen (approximately 1.7-fold)

  • Significant impairment of TFPI's capability to inhibit TF-FVIIa–dependent FX activation

In ADTRP-silenced cells, TFPI inhibited only 12% of the total FXa generated, compared to 55% in control cells, indicating that ADTRP actively preserves the anticoagulant potential of TFPI on the endothelial cell surface .

Conversely, overexpression of ADTRP increased:

  • mRNA and protein expression of both ADTRP and TFPI

  • Colocalization of cell surface TFPI with TF (to approximately 90%, up from 63% in control cells)

  • Triple colocalization of TF/TFPI/Cav-1 to over 85% of total TF

  • TFPI-dependent inhibition of FXa by 1.6 times compared to control cells

The mechanism of TFPI regulation by ADTRP involves transcription factor POU1F1, identified as the key regulator of TFPI mRNA expression induced by ADTRP .

Response to Androgens

ADTRP mediates the androgen-dependent upregulation of TFPI in endothelial cells. Dihydrotestosterone (DHT), the main metabolite of testosterone, increases the mRNA expression, protein levels, and anticoagulant capabilities of cell-associated TFPI in human endothelial cells in culture through an ADTRP-dependent mechanism .

This androgen responsiveness is likely due to potential half-androgen response elements (half-AREs) in the ADTRP promoter, which are similar to those identified in FAR-17a, the hamster homolog of human AIG1 . The ADTRP-mediated transcriptional regulation of TFPI by androgen may involve these AREs in the ADTRP promoter and androgen receptor-collaborating transcription factors .

Experimental data showed that:

  • Androgen enhanced cell surface TFPI activity by approximately 2-fold in native TF-EC (tissue factor-expressing endothelial cells)

  • TFPI mRNA failed to increase in response to androgen in ADTRP-silenced endothelial cells

  • Androgen failed to significantly increase TFPI-dependent FXa inhibition in ADTRP-silenced cells

These findings highlight the essential role of ADTRP in mediating the anticoagulant effects of androgens, which may partially explain the athero-protective effects of androgens observed in some clinical settings .

Role in Vascular Development and Function

Beyond its role in regulating TFPI, ADTRP plays a critical role in vascular development, stability, and function, as demonstrated in knockout mouse models . Studies show that ADTRP regulates Wnt signaling-dependent expression of genes that control vascular stability and integrity .

Gene expression analysis of ADTRP-deficient mice compared to wild-type revealed differential regulation of multiple genes involved in vascular function, as shown in Table 1:

FunctionGenes Up- or Down-Regulated in Adtrp−/− versus Wild-Type MiceFold Ratio
Endothelial cell permeabilityCdh5 (CD144; VE-Cadherin)0.46
Cldn5 (claudin-5)0.39
Klf4 (Krueppel like factor-4)0.18
Hif3α (hypoxia-inducible factor-3a)2.95
Mast cell components and regulatorsKtlg (Kit Ligand)2.18
Fcer1α (IgE receptor)3.65
Spi1 (transcription factor PU.1)2.60
L1cam (CD171; L1 cell adhesion molecule)1.90
Dpp4 (CD26; dipeptidyl peptidase 4)1.60
Hdc (histidine decarboxylase)5.65
Srgn (serglycin)2.30
Tpsab1 (MCP-7; tryptase)2.27
Mcpt4 (beta-chymase; MCP-4)2.32

ADTRP deficiency in mice led to accumulation of mast cells in tissue, many of which appeared degranulated, coinciding with edema and extravasated red blood cells . This suggests that ADTRP regulates vascular integrity and prevents excessive inflammatory responses.

Production and Properties of Recombinant Human ADTRP

Recombinant Human ADTRP represents the laboratory-produced version of the naturally occurring protein, created using recombinant DNA technology. This approach allows for controlled production of the protein for research purposes and potential therapeutic applications.

The production of recombinant ADTRP typically involves expressing the human ADTRP gene in a suitable host system, such as bacterial, yeast, insect, or mammalian cells. For functional studies, mammalian expression systems are often preferred to ensure proper post-translational modifications, particularly palmitoylation, which is crucial for ADTRP's membrane localization and function .

Research has demonstrated that palmitoylation-deficient ADTRP mutants fail to increase TFPI anticoagulant activity, highlighting the importance of preserving these modifications in recombinant preparations . Therefore, production systems capable of performing these modifications are essential for producing functionally active recombinant ADTRP.

For experimental studies, FLAG-tagged ADTRP constructs have been employed to facilitate detection and purification while studying the protein's function . Such epitope tagging strategies allow for efficient tracking of the recombinant protein in cellular systems.

Association with Cardiovascular Diseases

Genome-wide association studies have revealed that single-nucleotide polymorphisms in the ADTRP gene associate with several cardiovascular conditions:

  • Deep vein thrombosis/venous thromboembolism

  • Myocardial infarction

  • Coronary artery disease

The mechanisms behind these associations may involve regulation of melanoma inhibitory activity protein 3 (MIA3)/transport and Golgi organization protein 1 (TANGO1), collagen VII, and apolipoprotein B (ApoB) .

ADTRP as a Biomarker

A significant discovery in ADTRP research is its presence in human circulation and its potential as a biomarker for coronary artery disease (CAD). A study by Ooi et al. demonstrated that:

  • CAD patients had significantly lower plasma ADTRP levels (1,545 pg/ml, range 1,087–2,408 pg/ml) compared to:

    • CAD controls (2,259 pg/ml, range 1,533–3,778 pg/ml)

    • Healthy adults (3,904 pg/ml, range 2,732–5,463 pg/ml)

  • Plasma ADTRP outperformed other inflammatory biomarkers (TNF-α, IL-6, and hs-CRP) for CAD prediction with an Area under ROC curve of 0.67 and Odds ratio of 0.907

This study was the first to demonstrate that ADTRP is present in circulation and that plasma ADTRP may serve as a novel independent biomarker for CAD .

Therapeutic Potential

The multifaceted roles of ADTRP in regulating anticoagulation, vascular development, and potentially metabolic processes suggest several therapeutic applications:

  1. Cardiovascular protection: Recombinant ADTRP could potentially enhance endothelial anticoagulant function through upregulation of TFPI expression and activity, particularly in conditions of endothelial dysfunction or low androgen states .

  2. Anti-thrombotic therapy: Given its role in enhancing TFPI-dependent inhibition of the tissue factor pathway, recombinant ADTRP might serve as a novel anti-thrombotic agent with potential applications in conditions such as coronary artery disease, deep vein thrombosis, venous thromboembolism, sepsis, and cancer .

  3. Vascular stability: The role of ADTRP in maintaining vascular integrity suggests potential applications in conditions characterized by increased vascular permeability .

Future Research Directions

Despite significant advances in understanding ADTRP's functions, several areas require further investigation:

  1. Detailed structural characterization of recombinant human ADTRP to facilitate structure-based drug design

  2. Comprehensive understanding of ADTRP's enzymatic activities and their physiological significance

  3. Development of recombinant ADTRP variants with enhanced stability or function for therapeutic applications

  4. Clinical trials to evaluate the efficacy of recombinant ADTRP in treating cardiovascular diseases

  5. Exploration of ADTRP's role in other physiological and pathological processes beyond cardiovascular function

Product Specs

Buffer
For liquid delivery form, the default storage buffer is a Tris/PBS-based solution containing 5%-50% glycerol.

Note: If you have a specific requirement for the glycerol content, please indicate it in your order remarks.
For lyophilized powder delivery form, the buffer used before lyophilization is a Tris/PBS-based solution containing 6% Trehalose.
Form
Available in either liquid or lyophilized powder form.
Note: We prioritize shipping the format that is currently in stock. However, if you have a specific format preference, please specify it in your order remarks, and we will prepare the product accordingly.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Synonyms
ADTRP; C6orf105; Androgen-dependent TFPI-regulating protein; Fatty acid esters of hydroxy fatty acids hydrolase ADTRP; FAHFA hydrolase ADTRP
Datasheet & Coa
Please contact us to get it.
Expression Region
1-230aa
Mol. Weight
31.8kDa
Protein Length
Full Length
Purity
Greater than 90% as determined by SDS-PAGE.
Source
in vitro E.coli expression system
Species
Homo sapiens (Human)
Target Names
ADTRP
Target Protein Sequence
MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGVTCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDTVIPVWLNHAMHTFIFPITLAEVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTWVYPVFAKLSLLGLAAFFSLSYVFIASIYLLGEKLNHWKWGDMRQPRKKRK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
This protein hydrolyzes bioactive fatty-acid esters of hydroxy-fatty acids (FAHFAs), but not other major lipid classes. It exhibits a preference for FAHFAs with branching distal from the carboxylate head group of the lipids. In endothelial cells, it regulates the expression and cell-associated anticoagulant activity of the inhibitor TFPI (in vitro).
Gene References Into Functions
  1. These data suggest that androgen's protection against coronary artery disease involves stimulating ADTRP expression. PMID: 28645652
  2. ADTRP positively regulates PIK3R3 expression, leading to AKT activation and up-regulation of MIA3/TANGO1, thereby directly influencing endothelial cell functions relevant to atherosclerosis. PMID: 28341552
  3. ADTRP increases the number of cells in the S phase during the cell cycle. PMID: 27235449
  4. These findings indicate that AIG1 and ADTRP are founding members of an evolutionarily conserved class of transmembrane threonine hydrolases involved in bioactive lipid metabolism. PMID: 27018888
  5. ADTRP is associated with the pathogenesis of early-onset CAD. PMID: 26375920
  6. SNP rs6903956 is associated with asymptomatic hyperuricemia susceptibility in the Han Chinese population. PMID: 25928384
  7. Activation of PPARG increases C6ORF105 expression in human macrophages and atherosclerotic lesions. PMID: 25595457
  8. ADTRP polymorphism is linked to the development of coronary atherosclerosis. PMID: 24573017
  9. The single nucleotide polymorphism rs6903956 within the ADTRP gene on chromosome 6p24.1 is significantly associated with coronary artery disease in diverse ethnic groups of the Singaporean population. PMID: 23337689
  10. This study confirms ADTRP expression and colocalization with TFPI and caveolin-1 in endothelial cells. PMID: 21868574

Show More

Hide All

Database Links

HGNC: 21214

OMIM: 614348

KEGG: hsa:84830

UniGene: Hs.126409

Protein Families
AIG1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in cultured endothelial cells and in placenta.

Q&A

What is the molecular structure and classification of ADTRP?

ADTRP (Androgen-dependent TFPI-regulating protein) is a full-length human protein consisting of 230 amino acids. The protein sequence begins with MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGVTCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFW and continues through to its C-terminus. Structurally, ADTRP belongs to the AIG1 family of proteins, which are characterized by specific conserved domains. The protein can be produced recombinantly in cell-free systems with ≥90% purity, making it suitable for various biochemical analyses including SDS-PAGE . Understanding this basic structural information is essential for designing experiments involving protein-protein interactions, enzymatic assays, and structural studies.

What are the primary biological functions of ADTRP?

ADTRP exhibits multiple biological functions across different physiological systems. First, it functions as a hydrolase that specifically cleaves bioactive fatty-acid esters of hydroxy-fatty acids (FAHFAs), showing preference for those with branching distal from the carboxylate head group, while not affecting other major lipid classes . Second, it regulates the expression and cell-associated anticoagulant activity of tissue factor pathway inhibitor (TFPI) in endothelial cells . Third, it plays a crucial role in vascular development and stability by negatively regulating canonical Wnt signaling pathways, particularly affecting membrane events downstream of low-density lipoprotein receptor-related protein 6 (LRP6) and upstream of glycogen synthase kinase 3 beta . Additionally, ADTRP is involved in metabolic regulation, particularly in the thermogenic activity of adipose tissue through its interaction with S100 calcium-binding protein b (S100b) .

How can researchers generate ADTRP knockout models for experimental studies?

Creating ADTRP knockout models requires strategic gene editing approaches. For mouse models, researchers have successfully used a complex strategy involving LoxP sites flanking critical exons of the Adtrp gene. Specifically, introducing LoxP sites flanking both exons 2 and 5 has proven effective because exons 2-5 share in-frame splice junctions, and removing just one of these exons would not produce a frameshift event . The bacterial artificial chromosome targeting vector approach can be used, introducing LoxP sites in introns 1, 2, 4, and 5, along with FRT-flanked resistance cassettes. After validation, the construct is introduced into embryonic stem cells (preferably C57BL/6), which are then injected into albino blastocysts. The resulting chimeras are mated, and offspring positive for the mutant allele are crossed with ROSA26-Flpe+ mice to remove resistance cassettes . For zebrafish models, morpholino oligonucleotides (MOs) targeting the splice junctions of adtrp (e.g., 5′-TCACTGTTAAAATTCACCTGTGCAT-3′ and 5′-ACAAACGAATGATCTCACCATTGCA-3′) have been successfully employed .

How does ADTRP regulate vascular development and what molecular mechanisms underlie its role in vascular stability?

ADTRP plays a crucial role in vascular development and stability through complex molecular interactions. Genetic inhibition of Adtrp in both zebrafish embryos and newborn mice results in vascular malformations primarily in the low-pressure vasculature, characterized by dilation, tortuosity, perivascular inflammation, extravascular proteolysis, increased permeability, and microhemorrhages . These vascular abnormalities can lead to partially penetrant lethality in animal models.

The molecular mechanism involves ADTRP's negative regulation of canonical Wnt signaling pathways. Specifically, ADTRP affects membrane events downstream of LRP6 and upstream of glycogen synthase kinase 3 beta . In ADTRP-deficient models, there is increased aberrant/ectopic Wnt/β-catenin signaling, leading to upregulation of matrix metallopeptidase-9 (MMP-9) in endothelial cells and mast cells. This upregulation of MMP-9 is demonstrably downstream of canonical Wnt signaling, as Wnt-pathway inhibition reverses the increased mmp9 expression in zebrafish embryos lacking Adtrp .

Vascular leakiness in ADTRP-deficient models correlates with decreased endothelial cell junction components, particularly VE-cadherin and claudin-5 . Additionally, vascular lesions in newborn Adtrp-/- mice show accumulation of mast cells, decreased extracellular matrix content, and deficient perivascular cell coverage, suggesting multiple mechanisms through which ADTRP maintains vascular integrity .

What is the relationship between ADTRP and coronary artery disease (CAD), and how can ADTRP serve as a biomarker?

ADTRP has emerged as a potential novel biomarker for coronary artery disease (CAD). Research has demonstrated that ADTRP is present in circulation, and plasma ADTRP levels are significantly reduced in CAD patients (1,545 pg/ml, range: 1,087–2,408 pg/ml) compared to angiographically negative CAD controls (2,259 pg/ml, range: 1,533–3,778 pg/ml) and healthy adults (3,904 pg/ml, range: 2,732–5,463 pg/ml) .

Performance analysis shows that plasma ADTRP outperforms established inflammatory biomarkers such as TNF-α, IL-6, and high-sensitivity C-reactive protein (hs-CRP) in identifying CAD . This suggests that ADTRP measurement could provide additional diagnostic value beyond traditional biomarkers. The inverse relationship between ADTRP levels and CAD risk is consistent with genetic studies showing that reduced mRNA expression of ADTRP is associated with increased CAD susceptibility.

For researchers investigating ADTRP as a biomarker, it's important to consider age, gender, ethnicity, and BMI as potential confounding factors when analyzing plasma ADTRP levels. Appropriate statistical methods include receiver operator characteristic curves, quantile regression, and logistic regression, with adjustments for these demographic variables .

How does ADTRP contribute to thermogenic regulation in adipose tissue?

ADTRP plays a significant role in regulating thermogenesis in adipose tissue through a novel molecular pathway. Research has identified ADTRP as being significantly overexpressed in and functionally activating mature brown/beige adipocytes . Knockout studies in mice have demonstrated that Adtrp deletion leads to multiple abnormalities in thermogenesis, metabolism, and maturation of brown/beige adipocytes, resulting in excess lipid accumulation in brown adipose tissue (BAT) and cold intolerance .

The molecular mechanism involves ADTRP binding to S100 calcium-binding protein b (S100b), which indirectly mediates the secretion of S100b. This secreted S100b then promotes β3-adrenergic receptor (β3-AR) mediated thermogenesis via sympathetic innervation . Supporting this mechanism, the thermogenic capacity in brown/beige adipose tissues can be recovered in Adtrp knockout mice upon direct β3-AR stimulation through CL316,243 treatment .

This research provides important insights for scientists studying metabolic disorders, as it establishes ADTRP as a regulator of differentiation and thermogenesis of adipose tissues in mice, potentially opening new avenues for therapeutic approaches to obesity and related metabolic conditions.

What techniques are most effective for measuring ADTRP in circulation and tissue samples?

For quantifying ADTRP in human plasma samples, commercial enzyme-linked immunosorbent assay (ELISA) kits have been successfully employed in clinical research settings . When measuring circulating ADTRP, researchers should collect blood samples in appropriate anticoagulant tubes (typically EDTA), followed by careful processing to obtain plasma, with attention to standardized centrifugation protocols to ensure consistency. Sample storage at -80°C is recommended to maintain protein stability until analysis.

For tissue samples, immunohistochemistry techniques can be employed to localize ADTRP expression in specific cell types. In mouse studies, researchers have successfully identified ADTRP expression in brown and beige adipose tissues . RNA-based methods such as quantitative PCR can be used to measure ADTRP mRNA expression levels in tissues, providing insights into transcriptional regulation.

When conducting in vitro studies, researchers can employ siRNA techniques for silencing ADTRP expression. For example, ADTRP-siRNA transfection in EA.hy926 endothelial cells using Lipofectamine 2000 has been successfully used to study ADTRP function . For overexpression studies, plasmid-based approaches using vectors such as pCMV6-Entry/ADTRP-FLAG have been employed .

How can researchers effectively study ADTRP's enzymatic activity toward fatty-acid esters of hydroxy-fatty acids (FAHFAs)?

Studying ADTRP's enzymatic activity toward FAHFAs requires careful experimental design and specialized techniques. Researchers should begin with purified recombinant ADTRP protein, which can be expressed in cell-free systems to achieve ≥90% purity . The enzymatic assay should include various FAHFA substrates, particularly those with branching distal from the carboxylate head group, as ADTRP shows preference for these structures .

For substrate preparation, synthetic FAHFAs can be used, or natural FAHFAs can be isolated from biological samples using liquid chromatography techniques. Reaction conditions should be optimized for pH, temperature, and cofactor requirements. The enzymatic activity can be monitored by measuring the hydrolysis products using liquid chromatography-mass spectrometry (LC-MS) or similar analytical techniques.

Control experiments should include assays with other major lipid classes to confirm ADTRP's specificity for FAHFAs . Additionally, site-directed mutagenesis of putative catalytic residues can help identify the active site and mechanism of ADTRP's hydrolase activity. For kinetic analysis, researchers should determine Km and Vmax values using varied substrate concentrations under optimal reaction conditions.

What are the optimal approaches for investigating ADTRP's role in Wnt signaling pathways?

Investigating ADTRP's role in Wnt signaling requires multiple complementary approaches. Cell-based reporter assays have successfully demonstrated that ADTRP negatively regulates canonical Wnt signaling . Researchers can employ TOPFlash/FOPFlash luciferase reporter systems, which contain TCF/LEF binding sites that respond to β-catenin-mediated transcriptional activation.

For mechanistic studies, co-transfection experiments with ADTRP and key Wnt pathway components have proven informative. Specifically, cells can be cotransfected with ADTRP or control plasmids, plus one of the following: full-length β-CATENIN, constitutively active β-CATENIN S37A, or constitutively active low-density lipoprotein receptor-related protein 6 (LRP6)ΔN-pCS2-VSVG . Luciferase activity measured after 48 hours can indicate where in the pathway ADTRP exerts its regulatory effects.

In vivo, Wnt signaling activity can be assessed in ADTRP-deficient models using transgenic Wnt reporter lines. For zebrafish studies, morpholino knockdown of adtrp followed by analysis of Wnt target gene expression (e.g., mmp9) with and without Wnt-pathway inhibitors can help establish causality . In mouse models, immunohistochemistry for β-catenin localization and qPCR for Wnt target genes in Adtrp-/- versus wild-type tissues can provide evidence of aberrant/ectopic Wnt/β-catenin signaling .

How should researchers interpret conflicting data regarding ADTRP's role in different tissue types?

When faced with seemingly conflicting data about ADTRP's function across different tissues, researchers should consider several interpretations and validation approaches. First, recognize that ADTRP likely has tissue-specific functions, as evidenced by its distinct roles in vascular endothelium versus adipose tissue . This tissue specificity may arise from differential protein expression levels, varying cofactor availability, or tissue-specific protein-protein interactions.

Second, consider developmental timing effects, as ADTRP's function may vary during embryonic development versus adult homeostasis. In zebrafish and mouse models, ADTRP deficiency causes developmental vascular abnormalities , while in adult mice, it affects thermogenic regulation in adipose tissue . These temporal differences should be explicitly acknowledged when interpreting data.

Third, methodological differences can contribute to apparent inconsistencies. For instance, global knockout models may show different phenotypes than tissue-specific knockdowns due to compensatory mechanisms or secondary effects. Researchers should validate findings using multiple approaches (e.g., both in vitro silencing and in vivo knockout) and consider using conditional knockout models to examine tissue-specific effects.

Finally, integrate findings from human studies with animal models. For example, the observed reduction of circulating ADTRP in CAD patients aligns with vascular phenotypes in animal models , suggesting translational relevance despite species differences.

What is the significance of the relationship between ADTRP, S100b, and β3-adrenergic receptor signaling in brown adipose tissue?

The relationship between ADTRP, S100b, and β3-adrenergic receptor (β3-AR) signaling represents a novel regulatory pathway in brown adipose tissue thermogenesis with significant implications for metabolic research. ADTRP binds to S100b and indirectly mediates its secretion, which in turn promotes β3-AR mediated thermogenesis via sympathetic innervation .

This relationship is particularly significant because it establishes ADTRP as a molecular link between protein secretion pathways and adrenergic signaling in adipose tissue. The fact that thermogenic capability in Adtrp knockout mice can be recovered upon direct β3-AR stimulation with CL316,243 indicates that ADTRP functions upstream of β3-AR activation but is critical for the normal functioning of this pathway.

The identification of this pathway also provides new avenues for investigating how environmental factors (e.g., cold exposure) and hormonal signals (e.g., androgens, given ADTRP's androgen-dependent regulation) might converge to regulate adaptive thermogenesis through ADTRP-mediated mechanisms.

How do the multiple functions of ADTRP integrate within a cohesive biological framework?

ADTRP exhibits seemingly diverse functions across different biological systems, but these can be integrated within a cohesive biological framework centered on lipid metabolism and tissue homeostasis. The protein's hydrolase activity toward FAHFAs suggests a primary role in lipid metabolism, which impacts both vascular function and adipose tissue biology.

In vascular tissue, ADTRP regulates TFPI expression and anticoagulant activity , while also negatively regulating Wnt signaling to maintain vascular stability . These functions may be linked through lipid-mediated signaling, as both coagulation cascades and Wnt pathways involve lipid-dependent processes. The upregulation of MMP-9 in endothelial cells upon ADTRP deficiency suggests that ADTRP helps maintain the extracellular matrix composition essential for vascular integrity.

In adipose tissue, ADTRP regulates thermogenesis through interaction with S100b and subsequent β3-AR signaling . This function may relate to its role in lipid metabolism, as proper thermogenic function requires efficient lipid mobilization and oxidation. The fact that ADTRP knockout leads to excess lipid accumulation in brown adipose tissue supports this integrated view of ADTRP as a regulator of lipid homeostasis across tissues.

The presence of ADTRP in circulation further suggests a systemic role, potentially coordinating responses across multiple tissues. Researchers should consider this integrative framework when designing experiments to investigate ADTRP function in specific contexts.

How does recombinant human ADTRP compare to the native protein in functional assays?

When using recombinant human ADTRP in research, it's essential to understand how its properties compare to the native protein. Recombinant human ADTRP, typically produced in cell-free expression systems, consists of the full-length protein (230 amino acids) with ≥90% purity . While this provides a valuable research tool, there are several considerations when comparing to native ADTRP.

First, post-translational modifications may differ between recombinant and native ADTRP. Cell-free systems may not reproduce all the modifications present in vivo, potentially affecting protein activity or interaction capabilities. Researchers should validate key findings using native protein sources when possible.

Third, for functional studies of ADTRP's role in Wnt signaling, complementation experiments are valuable. For example, human ADTRP mRNA synthesized from pCMV6-Entry/ADTRP-FLAG has been used successfully to rescue phenotypes in zebrafish adtrp morphants , suggesting functional conservation despite species differences.

Finally, when studying ADTRP's interaction with S100b in thermogenic regulation, researchers should consider using proximity ligation assays or co-immunoprecipitation with both recombinant and native proteins to confirm that the observed interactions represent physiologically relevant phenomena.

What are the most promising therapeutic applications of ADTRP research?

Based on current understanding of ADTRP's biological functions, several promising therapeutic applications emerge. First, given ADTRP's role as a potential biomarker for CAD with plasma levels significantly lower in CAD patients , developing diagnostic tests that measure circulating ADTRP could improve CAD risk assessment beyond traditional biomarkers. Such tests could potentially help identify at-risk individuals before clinical manifestations appear.

Second, therapeutic strategies targeting ADTRP's role in vascular stability may be valuable for treating or preventing vascular malformations. Since ADTRP deficiency leads to vascular abnormalities through aberrant Wnt signaling and increased MMP-9 expression , developing compounds that either upregulate ADTRP expression or mimic its inhibitory effect on Wnt signaling could potentially treat vascular instability conditions.

Third, ADTRP's role in adipose tissue thermogenesis suggests applications in metabolic disorders. Enhancing ADTRP function in brown/beige adipose tissues could potentially increase energy expenditure and combat obesity by promoting adaptive thermogenesis. Conversely, in conditions where excess energy expenditure is problematic, modulating the ADTRP-S100b-β3-AR pathway might help conserve energy.

Finally, as a hydrolase for FAHFAs , ADTRP may be relevant to conditions involving dysregulated lipid metabolism. Understanding how ADTRP-mediated FAHFA hydrolysis affects metabolic homeostasis could lead to novel approaches for treating hyperlipidemia or related disorders.

Researchers pursuing these therapeutic directions should consider tissue-specific targeting strategies to avoid unintended effects, given ADTRP's multiple functions across different tissues.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.