Recombinant Human Androgen-dependent TFPI-regulating protein (ADTRP)

What is the molecular structure and classification of ADTRP?

ADTRP (Androgen-dependent TFPI-regulating protein) is a full-length human protein consisting of 230 amino acids. The protein sequence begins with MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGVTCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFW and continues through to its C-terminus. Structurally, ADTRP belongs to the AIG1 family of proteins, which are characterized by specific conserved domains. The protein can be produced recombinantly in cell-free systems with ≥90% purity, making it suitable for various biochemical analyses including SDS-PAGE . Understanding this basic structural information is essential for designing experiments involving protein-protein interactions, enzymatic assays, and structural studies.

What are the primary biological functions of ADTRP?

ADTRP exhibits multiple biological functions across different physiological systems. First, it functions as a hydrolase that specifically cleaves bioactive fatty-acid esters of hydroxy-fatty acids (FAHFAs), showing preference for those with branching distal from the carboxylate head group, while not affecting other major lipid classes . Second, it regulates the expression and cell-associated anticoagulant activity of tissue factor pathway inhibitor (TFPI) in endothelial cells . Third, it plays a crucial role in vascular development and stability by negatively regulating canonical Wnt signaling pathways, particularly affecting membrane events downstream of low-density lipoprotein receptor-related protein 6 (LRP6) and upstream of glycogen synthase kinase 3 beta . Additionally, ADTRP is involved in metabolic regulation, particularly in the thermogenic activity of adipose tissue through its interaction with S100 calcium-binding protein b (S100b) .

How can researchers generate ADTRP knockout models for experimental studies?

Creating ADTRP knockout models requires strategic gene editing approaches. For mouse models, researchers have successfully used a complex strategy involving LoxP sites flanking critical exons of the Adtrp gene. Specifically, introducing LoxP sites flanking both exons 2 and 5 has proven effective because exons 2-5 share in-frame splice junctions, and removing just one of these exons would not produce a frameshift event . The bacterial artificial chromosome targeting vector approach can be used, introducing LoxP sites in introns 1, 2, 4, and 5, along with FRT-flanked resistance cassettes. After validation, the construct is introduced into embryonic stem cells (preferably C57BL/6), which are then injected into albino blastocysts. The resulting chimeras are mated, and offspring positive for the mutant allele are crossed with ROSA26-Flpe+ mice to remove resistance cassettes . For zebrafish models, morpholino oligonucleotides (MOs) targeting the splice junctions of adtrp (e.g., 5′-TCACTGTTAAAATTCACCTGTGCAT-3′ and 5′-ACAAACGAATGATCTCACCATTGCA-3′) have been successfully employed .

How does ADTRP regulate vascular development and what molecular mechanisms underlie its role in vascular stability?

ADTRP plays a crucial role in vascular development and stability through complex molecular interactions. Genetic inhibition of Adtrp in both zebrafish embryos and newborn mice results in vascular malformations primarily in the low-pressure vasculature, characterized by dilation, tortuosity, perivascular inflammation, extravascular proteolysis, increased permeability, and microhemorrhages . These vascular abnormalities can lead to partially penetrant lethality in animal models.

The molecular mechanism involves ADTRP's negative regulation of canonical Wnt signaling pathways. Specifically, ADTRP affects membrane events downstream of LRP6 and upstream of glycogen synthase kinase 3 beta . In ADTRP-deficient models, there is increased aberrant/ectopic Wnt/β-catenin signaling, leading to upregulation of matrix metallopeptidase-9 (MMP-9) in endothelial cells and mast cells. This upregulation of MMP-9 is demonstrably downstream of canonical Wnt signaling, as Wnt-pathway inhibition reverses the increased mmp9 expression in zebrafish embryos lacking Adtrp .

Vascular leakiness in ADTRP-deficient models correlates with decreased endothelial cell junction components, particularly VE-cadherin and claudin-5 . Additionally, vascular lesions in newborn Adtrp-/- mice show accumulation of mast cells, decreased extracellular matrix content, and deficient perivascular cell coverage, suggesting multiple mechanisms through which ADTRP maintains vascular integrity .

What is the relationship between ADTRP and coronary artery disease (CAD), and how can ADTRP serve as a biomarker?

ADTRP has emerged as a potential novel biomarker for coronary artery disease (CAD). Research has demonstrated that ADTRP is present in circulation, and plasma ADTRP levels are significantly reduced in CAD patients (1,545 pg/ml, range: 1,087–2,408 pg/ml) compared to angiographically negative CAD controls (2,259 pg/ml, range: 1,533–3,778 pg/ml) and healthy adults (3,904 pg/ml, range: 2,732–5,463 pg/ml) .

Performance analysis shows that plasma ADTRP outperforms established inflammatory biomarkers such as TNF-α, IL-6, and high-sensitivity C-reactive protein (hs-CRP) in identifying CAD . This suggests that ADTRP measurement could provide additional diagnostic value beyond traditional biomarkers. The inverse relationship between ADTRP levels and CAD risk is consistent with genetic studies showing that reduced mRNA expression of ADTRP is associated with increased CAD susceptibility.

For researchers investigating ADTRP as a biomarker, it's important to consider age, gender, ethnicity, and BMI as potential confounding factors when analyzing plasma ADTRP levels. Appropriate statistical methods include receiver operator characteristic curves, quantile regression, and logistic regression, with adjustments for these demographic variables .

How does ADTRP contribute to thermogenic regulation in adipose tissue?

ADTRP plays a significant role in regulating thermogenesis in adipose tissue through a novel molecular pathway. Research has identified ADTRP as being significantly overexpressed in and functionally activating mature brown/beige adipocytes . Knockout studies in mice have demonstrated that Adtrp deletion leads to multiple abnormalities in thermogenesis, metabolism, and maturation of brown/beige adipocytes, resulting in excess lipid accumulation in brown adipose tissue (BAT) and cold intolerance .

The molecular mechanism involves ADTRP binding to S100 calcium-binding protein b (S100b), which indirectly mediates the secretion of S100b. This secreted S100b then promotes β3-adrenergic receptor (β3-AR) mediated thermogenesis via sympathetic innervation . Supporting this mechanism, the thermogenic capacity in brown/beige adipose tissues can be recovered in Adtrp knockout mice upon direct β3-AR stimulation through CL316,243 treatment .

This research provides important insights for scientists studying metabolic disorders, as it establishes ADTRP as a regulator of differentiation and thermogenesis of adipose tissues in mice, potentially opening new avenues for therapeutic approaches to obesity and related metabolic conditions.

What techniques are most effective for measuring ADTRP in circulation and tissue samples?

For quantifying ADTRP in human plasma samples, commercial enzyme-linked immunosorbent assay (ELISA) kits have been successfully employed in clinical research settings . When measuring circulating ADTRP, researchers should collect blood samples in appropriate anticoagulant tubes (typically EDTA), followed by careful processing to obtain plasma, with attention to standardized centrifugation protocols to ensure consistency. Sample storage at -80°C is recommended to maintain protein stability until analysis.

For tissue samples, immunohistochemistry techniques can be employed to localize ADTRP expression in specific cell types. In mouse studies, researchers have successfully identified ADTRP expression in brown and beige adipose tissues . RNA-based methods such as quantitative PCR can be used to measure ADTRP mRNA expression levels in tissues, providing insights into transcriptional regulation.

When conducting in vitro studies, researchers can employ siRNA techniques for silencing ADTRP expression. For example, ADTRP-siRNA transfection in EA.hy926 endothelial cells using Lipofectamine 2000 has been successfully used to study ADTRP function . For overexpression studies, plasmid-based approaches using vectors such as pCMV6-Entry/ADTRP-FLAG have been employed .

How can researchers effectively study ADTRP's enzymatic activity toward fatty-acid esters of hydroxy-fatty acids (FAHFAs)?

Studying ADTRP's enzymatic activity toward FAHFAs requires careful experimental design and specialized techniques. Researchers should begin with purified recombinant ADTRP protein, which can be expressed in cell-free systems to achieve ≥90% purity . The enzymatic assay should include various FAHFA substrates, particularly those with branching distal from the carboxylate head group, as ADTRP shows preference for these structures .

For substrate preparation, synthetic FAHFAs can be used, or natural FAHFAs can be isolated from biological samples using liquid chromatography techniques. Reaction conditions should be optimized for pH, temperature, and cofactor requirements. The enzymatic activity can be monitored by measuring the hydrolysis products using liquid chromatography-mass spectrometry (LC-MS) or similar analytical techniques.

Control experiments should include assays with other major lipid classes to confirm ADTRP's specificity for FAHFAs . Additionally, site-directed mutagenesis of putative catalytic residues can help identify the active site and mechanism of ADTRP's hydrolase activity. For kinetic analysis, researchers should determine Km and Vmax values using varied substrate concentrations under optimal reaction conditions.

What are the optimal approaches for investigating ADTRP's role in Wnt signaling pathways?

Investigating ADTRP's role in Wnt signaling requires multiple complementary approaches. Cell-based reporter assays have successfully demonstrated that ADTRP negatively regulates canonical Wnt signaling . Researchers can employ TOPFlash/FOPFlash luciferase reporter systems, which contain TCF/LEF binding sites that respond to β-catenin-mediated transcriptional activation.

For mechanistic studies, co-transfection experiments with ADTRP and key Wnt pathway components have proven informative. Specifically, cells can be cotransfected with ADTRP or control plasmids, plus one of the following: full-length β-CATENIN, constitutively active β-CATENIN S37A, or constitutively active low-density lipoprotein receptor-related protein 6 (LRP6)ΔN-pCS2-VSVG . Luciferase activity measured after 48 hours can indicate where in the pathway ADTRP exerts its regulatory effects.

In vivo, Wnt signaling activity can be assessed in ADTRP-deficient models using transgenic Wnt reporter lines. For zebrafish studies, morpholino knockdown of adtrp followed by analysis of Wnt target gene expression (e.g., mmp9) with and without Wnt-pathway inhibitors can help establish causality . In mouse models, immunohistochemistry for β-catenin localization and qPCR for Wnt target genes in Adtrp-/- versus wild-type tissues can provide evidence of aberrant/ectopic Wnt/β-catenin signaling .

How should researchers interpret conflicting data regarding ADTRP's role in different tissue types?

When faced with seemingly conflicting data about ADTRP's function across different tissues, researchers should consider several interpretations and validation approaches. First, recognize that ADTRP likely has tissue-specific functions, as evidenced by its distinct roles in vascular endothelium versus adipose tissue . This tissue specificity may arise from differential protein expression levels, varying cofactor availability, or tissue-specific protein-protein interactions.

Second, consider developmental timing effects, as ADTRP's function may vary during embryonic development versus adult homeostasis. In zebrafish and mouse models, ADTRP deficiency causes developmental vascular abnormalities , while in adult mice, it affects thermogenic regulation in adipose tissue . These temporal differences should be explicitly acknowledged when interpreting data.

Third, methodological differences can contribute to apparent inconsistencies. For instance, global knockout models may show different phenotypes than tissue-specific knockdowns due to compensatory mechanisms or secondary effects. Researchers should validate findings using multiple approaches (e.g., both in vitro silencing and in vivo knockout) and consider using conditional knockout models to examine tissue-specific effects.

Finally, integrate findings from human studies with animal models. For example, the observed reduction of circulating ADTRP in CAD patients aligns with vascular phenotypes in animal models , suggesting translational relevance despite species differences.

What is the significance of the relationship between ADTRP, S100b, and β3-adrenergic receptor signaling in brown adipose tissue?

The relationship between ADTRP, S100b, and β3-adrenergic receptor (β3-AR) signaling represents a novel regulatory pathway in brown adipose tissue thermogenesis with significant implications for metabolic research. ADTRP binds to S100b and indirectly mediates its secretion, which in turn promotes β3-AR mediated thermogenesis via sympathetic innervation .

This relationship is particularly significant because it establishes ADTRP as a molecular link between protein secretion pathways and adrenergic signaling in adipose tissue. The fact that thermogenic capability in Adtrp knockout mice can be recovered upon direct β3-AR stimulation with CL316,243 indicates that ADTRP functions upstream of β3-AR activation but is critical for the normal functioning of this pathway.

The identification of this pathway also provides new avenues for investigating how environmental factors (e.g., cold exposure) and hormonal signals (e.g., androgens, given ADTRP's androgen-dependent regulation) might converge to regulate adaptive thermogenesis through ADTRP-mediated mechanisms.

How do the multiple functions of ADTRP integrate within a cohesive biological framework?

ADTRP exhibits seemingly diverse functions across different biological systems, but these can be integrated within a cohesive biological framework centered on lipid metabolism and tissue homeostasis. The protein's hydrolase activity toward FAHFAs suggests a primary role in lipid metabolism, which impacts both vascular function and adipose tissue biology.

In vascular tissue, ADTRP regulates TFPI expression and anticoagulant activity , while also negatively regulating Wnt signaling to maintain vascular stability . These functions may be linked through lipid-mediated signaling, as both coagulation cascades and Wnt pathways involve lipid-dependent processes. The upregulation of MMP-9 in endothelial cells upon ADTRP deficiency suggests that ADTRP helps maintain the extracellular matrix composition essential for vascular integrity.

In adipose tissue, ADTRP regulates thermogenesis through interaction with S100b and subsequent β3-AR signaling . This function may relate to its role in lipid metabolism, as proper thermogenic function requires efficient lipid mobilization and oxidation. The fact that ADTRP knockout leads to excess lipid accumulation in brown adipose tissue supports this integrated view of ADTRP as a regulator of lipid homeostasis across tissues.

The presence of ADTRP in circulation further suggests a systemic role, potentially coordinating responses across multiple tissues. Researchers should consider this integrative framework when designing experiments to investigate ADTRP function in specific contexts.

How does recombinant human ADTRP compare to the native protein in functional assays?

When using recombinant human ADTRP in research, it's essential to understand how its properties compare to the native protein. Recombinant human ADTRP, typically produced in cell-free expression systems, consists of the full-length protein (230 amino acids) with ≥90% purity . While this provides a valuable research tool, there are several considerations when comparing to native ADTRP.

First, post-translational modifications may differ between recombinant and native ADTRP. Cell-free systems may not reproduce all the modifications present in vivo, potentially affecting protein activity or interaction capabilities. Researchers should validate key findings using native protein sources when possible.

Third, for functional studies of ADTRP's role in Wnt signaling, complementation experiments are valuable. For example, human ADTRP mRNA synthesized from pCMV6-Entry/ADTRP-FLAG has been used successfully to rescue phenotypes in zebrafish adtrp morphants , suggesting functional conservation despite species differences.

Finally, when studying ADTRP's interaction with S100b in thermogenic regulation, researchers should consider using proximity ligation assays or co-immunoprecipitation with both recombinant and native proteins to confirm that the observed interactions represent physiologically relevant phenomena.

What are the most promising therapeutic applications of ADTRP research?

Based on current understanding of ADTRP's biological functions, several promising therapeutic applications emerge. First, given ADTRP's role as a potential biomarker for CAD with plasma levels significantly lower in CAD patients , developing diagnostic tests that measure circulating ADTRP could improve CAD risk assessment beyond traditional biomarkers. Such tests could potentially help identify at-risk individuals before clinical manifestations appear.

Second, therapeutic strategies targeting ADTRP's role in vascular stability may be valuable for treating or preventing vascular malformations. Since ADTRP deficiency leads to vascular abnormalities through aberrant Wnt signaling and increased MMP-9 expression , developing compounds that either upregulate ADTRP expression or mimic its inhibitory effect on Wnt signaling could potentially treat vascular instability conditions.

Third, ADTRP's role in adipose tissue thermogenesis suggests applications in metabolic disorders. Enhancing ADTRP function in brown/beige adipose tissues could potentially increase energy expenditure and combat obesity by promoting adaptive thermogenesis. Conversely, in conditions where excess energy expenditure is problematic, modulating the ADTRP-S100b-β3-AR pathway might help conserve energy.

Finally, as a hydrolase for FAHFAs , ADTRP may be relevant to conditions involving dysregulated lipid metabolism. Understanding how ADTRP-mediated FAHFA hydrolysis affects metabolic homeostasis could lead to novel approaches for treating hyperlipidemia or related disorders.

Researchers pursuing these therapeutic directions should consider tissue-specific targeting strategies to avoid unintended effects, given ADTRP's multiple functions across different tissues.