Recombinant Human Androgen-dependent TFPI-regulating protein (ADTRP)

Shipped with Ice Packs
In Stock

Description

Functional Role of Recombinant ADTRP in Research

Recombinant ADTRP enables mechanistic studies of its anticoagulant and vascular regulatory functions:

TFPI Regulation

  • ADTRP enhances TFPI mRNA expression and activity in ECs. Knockdown via ADTRP-shRNA reduces TFPI expression by >50%, while overexpression increases TFPI activity by ~95% .

  • Androgens like dihydrotestosterone (DHT) amplify this effect, doubling TFPI-dependent FXa inhibition in ECs .

Lipid Raft Association

  • ADTRP and TFPI colocalize with caveolin-1 (Cav-1) in lipid rafts/caveolae. Overexpression shifts TFPI to detergent-resistant membrane fractions, enhancing anticoagulant activity .

Wnt Signaling Modulation

  • ADTRP negatively regulates canonical Wnt/β-catenin signaling by interacting with LRP6, reducing matrix metallopeptidase-9 (MMP-9) expression and vascular permeability .

In Vitro Studies

  • EA.hy926 Endothelial Cells: Stimulation with recombinant ADTRP did not significantly alter TFPI mRNA levels but modulated genes involved in inflammation, apoptosis, and histone modifications .

  • Clinical Correlation: CAD patients exhibit lower plasma ADTRP levels compared to non-CAD individuals (p = 0.004) .

In Vivo Models

  • Zebrafish/Mice: Adtrp deficiency caused vascular malformations, inflammation, and hemorrhage due to disrupted Wnt signaling and MMP-9 overexpression .

Potential Clinical Applications

ADTRP’s roles in coagulation and vascular integrity highlight its therapeutic potential:

Disease AssociationMechanismReferences
Atherosclerosis/CADADTRP variants correlate with CAD risk; low ADTRP exacerbates endothelial dysfunction
ThrombosisEnhances TFPI activity, reducing TF-FVIIa–FXa coagulation
Metabolic DisordersActs as a FAHFA hydrolase, linking lipid metabolism to vascular health

Unresolved Questions and Future Directions

  • Mechanistic Pathways: How ADTRP transcriptionally regulates TFPI despite lacking direct DNA-binding domains .

  • Therapeutic Targeting: Feasibility of ADTRP-based therapies for thrombosis or vascular leak syndromes.

  • Metabolic Links: Role of ADTRP’s hydrolase activity in cardiometabolic diseases .

Product Specs

Buffer
If the delivery form is liquid, the default storage buffer is a Tris/PBS-based buffer containing 5%-50% glycerol.
Note: If you have specific requirements for the glycerol content, please indicate them when placing your order.
If the delivery form is lyophilized powder, the buffer used before lyophilization is a Tris/PBS-based buffer containing 6% Trehalose.

Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format we have in stock. However, if you have specific requirements for the format, please indicate your preference when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Synonyms
ADTRP; C6orf105; Androgen-dependent TFPI-regulating protein; Fatty acid esters of hydroxy fatty acids hydrolase ADTRP; FAHFA hydrolase ADTRP
Datasheet & Coa
Please contact us to get it.
Expression Region
1-230aa
Mol. Weight
46.8kDa
Protein Length
Full Length
Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
others
Source
in vitro E.coli expression system
Species
Homo sapiens (Human)
Target Names
ADTRP
Target Protein Sequence
MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGVTCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDTVIPVWLNHAMHTFIFPITLAEVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTWVYPVFAKLSLLGLAAFFSLSYVFIASIYLLGEKLNHWKWGDMRQPRKKRK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
Hydrolyzes bioactive fatty-acid esters of hydroxy-fatty acids (FAHFAs) but not other major classes of lipids. It demonstrates a preference for FAHFAs with branching distal from the carboxylate head group of the lipids. Regulates the expression and cell-associated anticoagulant activity of the inhibitor TFPI in endothelial cells (in vitro).
Gene References Into Functions
  1. These data suggest that one molecular mechanism by which androgen confers protection against coronary artery disease is stimulation of ADTRP expression. PMID: 28645652
  2. ADTRP positively regulates PIK3R3 expression, which leads to activation of AKT and up-regulation of MIA3/TANGO1, thereby regulating endothelial cell functions directly relevant to atherosclerosis. PMID: 28341552
  3. ADTRP increases the number of S phase cells during the cell cycle. PMID: 27235449
  4. These results indicate that AIG1 and ADTRP are founding members of an evolutionarily conserved class of transmembrane threonine hydrolases involved in bioactive lipid metabolism. PMID: 27018888
  5. Association of ADTRP with the pathogenesis of early-onset CAD PMID: 26375920
  6. SNP rs6903956 associated with asymptomatic hyperuricemia susceptibility in Han Chinese PMID: 25928384
  7. Activation of PPARG increases the expression of C6ORF105 in human macrophages and atherosclerotic lesions. PMID: 25595457
  8. ADTRP polymorphism is associated with the development of coronary atherosclerosis. PMID: 24573017
  9. The single nucleotide polymorphism rs6903956 within the ADTRP gene on chromosome 6p24.1 is significantly associated with coronary artery disease in different ethnic groups of the Singaporean population. PMID: 23337689
  10. This study confirms ADTRP expression and colocalization with TFPI and caveolin-1 in endothelial cells. PMID: 21868574

Show More

Hide All

Database Links

HGNC: 21214

OMIM: 614348

KEGG: hsa:84830

UniGene: Hs.126409

Protein Families
AIG1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in cultured endothelial cells and in placenta.

Q&A

What is ADTRP and what are its primary functions?

ADTRP (Androgen-dependent TFPI-regulating protein) is a novel protein first characterized in 2011 that regulates both the native and androgen-enhanced expression and activity of Tissue Factor Pathway Inhibitor (TFPI) in endothelial cells . ADTRP functions include:

  • Regulation of TFPI mRNA expression, cellular distribution, and cell-associated anticoagulant activity

  • Modulation of vessel integrity and vascular development through Wnt signaling-dependent regulation of matrix metalloproteinase-9 (MMP-9)

  • Hydrolysis of fatty acid esters of hydroxy-fatty acids, which exhibit anti-diabetic and anti-inflammatory effects

ADTRP is primarily localized in lipid rafts/caveolae of the cell membrane, where it colocalizes with both TFPI and caveolin-1 in endothelial cells . This membrane localization appears critical for its function, particularly in regulating TFPI activity.

How is ADTRP expression regulated?

ADTRP expression is primarily regulated by androgens, particularly dihydrotestosterone (DHT). The molecular mechanism involves direct binding of the androgen receptor to a half-androgen response element (half-ARE, TGTTCT) in the ADTRP promoter/regulatory region . Experimental evidence has demonstrated that:

  • Physiological concentrations of DHT increase both ADTRP and TFPI mRNA expression

  • The half-ARE sequence is critical for the transcriptional activation of ADTRP by testosterone

  • ADTRP expression increases approximately 2-fold following androgen treatment in endothelial cells

  • Both ADTRP and TFPI mRNA are upregulated in prostate cancer cell lines after incubation with DHT

What is the molecular structure of ADTRP?

According to UniProtKB/Swiss-Prot data, ADTRP (originally designated as C6ORF105, Protein Q96IZ2) has the following structural characteristics:

  • Two isoforms with molecular weights of approximately 27-29 kDa

  • 3-6 predicted transmembrane domains

  • Potential palmitoylation sites at Cys7 and Cys62/79, which may be responsible for its localization to lipid rafts/caveolae

  • Belongs to the AIG (androgen-induced gene) protein family

  • Sequence similarities to AIG1, which was cloned from human dermal papilla cells and is homologous to hamster FAR-17a

What is the relationship between ADTRP and cardiovascular disease?

Single-nucleotide polymorphisms (SNPs) in ADTRP have been associated with various cardiovascular conditions, suggesting that ADTRP may play a protective role in vascular health:

  • SNP rs6903956 in ADTRP has been associated with coronary artery disease (CAD) and myocardial infarction (MI)

  • ADTRP polymorphisms have also been linked to deep vein thrombosis (DVT) and venous thromboembolism (VTE)

  • The athero-protective effects of androgens may be partially exerted through the upregulation of ADTRP expression

How does ADTRP regulate TFPI function at the molecular level?

ADTRP regulates TFPI through multiple mechanisms that impact both expression and functional activity:

  • Transcriptional regulation: ADTRP influences TFPI mRNA expression, though the exact mechanism remains unclear since ADTRP is not known to function as a transcription factor itself

  • Membrane localization: ADTRP significantly enhances TFPI association with the detergent-resistant membrane fraction (lipid rafts) more than with the water-soluble fraction, suggesting ADTRP functions as a lipid raft organizer affecting TFPI distribution

  • Functional activity: ADTRP-silenced endothelial cells show reduced TFPI-dependent inhibition of Factor Xa generation, while ADTRP overexpression enhances this inhibitory activity

  • Response to androgens: The ADTRP-dependent upregulation of TFPI expression and activity by androgen represents a novel mechanism for increasing the anticoagulant protection of the endothelium

What phenotypic effects have been observed in ADTRP-deficient models?

Studies using ADTRP-deficient systems have revealed several important phenotypic consequences:

  • In mouse models, Adtrp deficiency did not reduce Tfpi expression but did affect TFPI-dependent lung-associated anticoagulant activity, suggesting ADTRP may regulate the membrane location and anticoagulant potential of TFPI in endothelial cells in vivo

  • ADTRP appears to play a critical role in vascular development and vessel integrity through Wnt signaling-dependent regulation of MMP-9

  • While ADTRP deficiency impacts anticoagulant activity, the effects seem to be tissue-specific, with pronounced effects observed in lung tissue

What are the recommended approaches for studying ADTRP-TFPI interactions?

To effectively investigate ADTRP-TFPI interactions, researchers should consider these methodological approaches:

  • Co-localization studies: Immunofluorescence and confocal microscopy to visualize ADTRP, TFPI, and caveolin-1 distribution in cell membranes. This can be quantified by measuring the percentage of co-localization in lipid rafts/caveolae .

  • Membrane fractionation: Triton X-114 extraction to separate detergent-resistant membrane fractions (D-fraction, lipid rafts) from water-soluble fractions (W-fraction) followed by Western blotting to assess protein distribution between these compartments .

  • Functional activity assays: Measure TFPI-dependent inhibition of Factor Xa generation using chromogenic substrates in:

    • Control cells

    • ADTRP-silenced cells (using shRNA)

    • ADTRP-overexpressing cells

    • Cells treated with androgens

  • Flow cytometry: To quantify cell surface expression of TFPI and ADTRP under different experimental conditions .

What expression systems are optimal for producing recombinant human ADTRP?

When producing recombinant human ADTRP for research purposes, consider these approaches:

  • Mammalian expression systems: Given ADTRP's complex post-translational modifications (particularly palmitoylation), mammalian cell lines such as HEK293 or CHO cells are preferred to ensure proper protein processing.

  • Expression constructs: Utilize expression vectors containing:

    • Full-length human ADTRP cDNA

    • C-terminal epitope tags (e.g., FLAG) for detection and purification

    • Palmitoylation-deficient mutants as negative controls

  • Inducible systems: Tetracycline-inducible expression systems can provide controlled expression levels to study dose-dependent effects.

  • Purification strategy: Two-step purification using affinity chromatography followed by size exclusion chromatography to obtain highly pure protein preparations.

How can researchers effectively silence or overexpress ADTRP in experimental models?

For manipulation of ADTRP expression levels, the following approaches have proven effective:

  • RNA interference:

    • shRNA targeting ADTRP has been successfully used to reduce ADTRP expression by >80% in endothelial cells

    • Consider using multiple shRNA constructs targeting different regions of the ADTRP transcript to confirm specificity

  • Overexpression strategies:

    • Transfection with ADTRP-FLAG constructs has been shown to increase ADTRP expression by approximately 5-fold in endothelial cells

    • Viral vectors (lentivirus or adenovirus) provide efficient delivery to hard-to-transfect cell types

  • CRISPR-Cas9 genome editing:

    • For complete knockout studies or introduction of specific mutations

    • Can be used to create cell lines with endogenous mutations in ADTRP regulatory regions

  • Validation methods:

    • qRT-PCR for mRNA expression

    • Western blotting and flow cytometry for protein expression

    • Functional assays to confirm phenotypic effects

How should researchers interpret changes in TFPI activity in relation to ADTRP expression?

When analyzing the relationship between ADTRP expression and TFPI activity, consider these interpretive guidelines:

  • Baseline correlation: Under normal conditions, ADTRP and TFPI expression show strong parallel coexpression with a statistically significant positive correlation (Pearson's r: 0.636; r²: 0.405) .

  • ADTRP silencing effects:

    • Expect approximately 50-60% reduction in TFPI mRNA and activity

    • TFPI inhibition of Factor Xa generation decreases from ~60% to ~30%

    • Cell surface TFPI expression decreases by ~40%

  • ADTRP overexpression effects:

    • Increases TFPI mRNA by ~1.7-fold

    • Enhances TFPI inhibition of Factor Xa generation to ~85%

    • Increases cell surface TFPI by ~1.6-fold

  • Androgen response interpretation:

    • In control cells, androgen enhances TFPI activity ~2-fold

    • This enhancement is absent in ADTRP-silenced cells

    • Androgen increases TFPI activity by only ~1.6-fold in ADTRP-overexpressing cells, suggesting partial saturation of the pathway

What factors might contribute to variability in ADTRP-related experimental results?

When investigating discrepancies in experimental results related to ADTRP function, consider these potential sources of variability:

  • Cell type differences:

    • ADTRP functions might vary between different endothelial cell types (e.g., HUVECs vs. microvascular endothelial cells)

    • Non-endothelial cells may exhibit different ADTRP regulatory mechanisms

  • Lipid raft integrity:

    • Experimental conditions that disrupt lipid rafts/caveolae will affect ADTRP function

    • Cell culture conditions affecting membrane composition can influence results

  • Androgen receptor expression:

    • Variable expression of androgen receptors between cell lines

    • Receptor polymorphisms affecting androgen response

  • Experimental timing:

    • Time-dependent responses to androgen stimulation (optimal at ~24 hours for DHT)

    • TFPI activity measurements are sensitive to timing of assays post-stimulation

  • Technical considerations:

    • Antibody specificity issues in detection methods

    • Differences in membrane fractionation techniques

How does ADTRP function in non-endothelial cellular contexts?

The role of ADTRP extends beyond endothelial cells, with varying functions observed in different cellular contexts:

  • Bone marrow-derived mesenchymal stem cells (BM-MSCs):

    • Decreased ADTRP mRNA expression observed after osteogenic induction

    • Suggests potential involvement in differentiation processes

  • Prostate cancer cells:

    • Both ADTRP and TFPI mRNA are upregulated after DHT treatment

    • Suggests conservation of the androgen-ADTRP-TFPI axis across cell types

  • Other tissues:

    • ADTRP expression has been confirmed in human placenta and baboon lung and aorta

    • Co-localization with TFPI and Cav-1 was observed in these tissues

    • Tissue-specific functions may exist independent of TFPI regulation

What are the most promising areas for further investigation of ADTRP function?

Based on current knowledge gaps, researchers should consider these high-priority research directions:

  • Structure-function relationships:

    • Determine the crystal structure of ADTRP

    • Identify critical domains for interaction with TFPI and other partners

    • Characterize the effects of naturally occurring polymorphisms on protein function

  • Transcriptional regulation mechanisms:

    • Elucidate how ADTRP regulates TFPI transcription

    • Identify potential transcription factor partners or signaling pathways

  • Role in disease models:

    • Investigate ADTRP in animal models of thrombosis, atherosclerosis, and vascular injury

    • Examine effects of ADTRP modulation on disease progression

  • Additional physiological functions:

    • Further characterize the enzymatic activity of ADTRP in hydrolyzing fatty acid esters

    • Investigate metabolic effects of ADTRP modulation

What technological advances might enhance ADTRP research?

Emerging technologies that could significantly advance ADTRP research include:

  • Single-cell analysis methods:

    • Single-cell RNA-seq to identify cell populations with highest ADTRP expression

    • Single-cell proteomics to study ADTRP-interacting proteins in specific cell types

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize ADTRP interactions in lipid rafts

    • Live-cell imaging with fluorescently tagged ADTRP to track dynamics

  • Computational approaches:

    • Machine learning algorithms to predict ADTRP interaction partners

    • Systems biology modeling of ADTRP in coagulation pathways

  • Therapeutic targeting strategies:

    • Development of small molecules that enhance ADTRP activity

    • miRNA-based approaches to modulate ADTRP expression

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.