Recombinant Human Ankyrin repeat domain-containing protein 46 (ANKRD46)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Human Ankyrin repeat domain-containing protein 46 (ANKRD46) is a protein that in humans is encoded by the ANKRD46 gene . The protein contains multiple ankyrin repeats, which are structural motifs that mediate protein-protein interactions involved in various cellular processes . Alternative splicing of the ANKRD46 gene results in multiple transcript variants . ANKRD46 is also known as ANK-S or GENX-115279 .

Gene and Protein Features

The ANKRD46 gene is part of the Ankyrin repeat domain containing (ANKRD) HGNC family . The ankyrin repeats, typically consisting of 33 amino acid segments, form two antiparallel α helices and a β-hairpin structure . These repeats facilitate protein-protein interactions .

Expression and Localization

ANKRD46 exhibits cytoplasmic and membranous expression in most tissues . In the brain, normalized RNA expression levels (nTPM) vary across different regions, as shown in the Human Protein Atlas .

Functional Associations

ANKRD46 has numerous functional associations with biological entities, spanning molecular profiles, organisms, chemicals, functional terms, diseases, phenotypes or traits, structural features, cell lines, cell types or tissues, genes, proteins, and microRNAs . These associations are extracted from various datasets .

Role in Disease

ANKRD46 has been implicated in certain diseases. A whole exome sequencing study identified protein truncating variants in ANKRD46 associated with loss of function that differed in frequency between individuals with alcohol use disorder (AUD) and controls . Although no genome wide significance was achieved, case enrichment for ANKRD46 suggests it as a candidate for follow-up studies .

Ankyrin Repeat Domains

Ankyrin repeats are common motifs in human proteins. Analyses of 257 well-annotated reviewed ankyrin repeat entries from the UniProtKB database show that approximately one-third of these proteins contain 5–6 copies of the repeating units . Ankyrin domain coverage, calculated as the ratio of amino acid residues in ankyrin copies to the total residues in the protein, averages around 33% across all proteins .

Data tables

HGNC FamilyAnkyrin repeat domain containing (ANKRD)
Nameankyrin repeat domain 46
DescriptionThis gene encodes a protein containing multiple ankyrin repeats. Ankyrin domains function in protein-protein interactions in a variety of cellular processes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2012]
SynonymsANK-S, GENX-115279
ProteinsANR46_HUMAN
NCBI Gene ID157567

Table 1: ANKRD46 Gene Information

GeneORp-value
AGTRAP352.241.01 × 10 –4
ANKRD46176.12.01 × 10 –4
PPA158.619.24 × 10 –4

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
ANKRD46; Ankyrin repeat domain-containing protein 46; Ankyrin repeat small protein; ANK-S
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-232
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
ANKRD46
Target Protein Sequence
MSYVFVNDSSQTNVPLLQACIDGDFNYSKRLLESGFDPNIRDSRGRTGLHLAAARGNVDI CQLLHKFGADLLATDYQGNTALHLCGHVDTIQFLVSNGLKIDICNHQGATPLVLAKRRGV NKDVIRLLESLEEQEVKGFNRGTHSKLETMQTAESESAMESHSLLNPNLQQGEGVLSSFR TTWQEFVEDLGFWRVLLLIFVIALLSLGIAYYRRTLRLGSFARQDRSRIQAI
Uniprot No.

Target Background

Database Links

HGNC: 27229

KEGG: hsa:157567

STRING: 9606.ENSP00000335287

UniGene: Hs.530199

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the structural composition of human ANKRD46?

ANKRD46 belongs to the ankyrin repeat-containing protein family, characterized by the presence of ankyrin repeat (AR) domains. Each ankyrin repeat typically consists of approximately 33 amino acids that form a characteristic β-hairpin–α-helix–loop–α-helix (β2α2) secondary structure . The number of ankyrin repeats in ANKRD46 contributes to its specific three-dimensional conformation, creating a concave palm surface formed by inner helices and a convex surface analogous to the back of a hand . This structural arrangement facilitates protein-protein interactions without necessarily recognizing specific primary sequences.

How does ANKRD46 differ from other ankyrin repeat domain-containing proteins?

While all ankyrin repeat domain-containing proteins share the characteristic ankyrin repeat motif, ANKRD46 differs in several ways:

  • Expression pattern: ANKRD46 shows distinct tissue expression profiles compared to other family members.

  • Prognostic correlation: Unlike some ANKRD family proteins (e.g., ANKRD9, ANKRD10, and ANKRD13D) that correlate with poor prognosis in renal cell carcinoma, ANKRD46 overexpression correlates with good prognosis .

  • Functional specificity: Despite structural similarities within the family, the ANK motif itself does not determine functional correlation (positive, negative, or none) with disease outcomes .

What are the evolutionary conservation patterns of ANKRD46 across species?

Ankyrin repeat domains are among the most abundant protein motifs in eukaryotic proteins, suggesting strong evolutionary conservation . For ANKRD46 specifically, comparative genomic analysis reveals:

SpeciesSequence HomologyConservation of Key DomainsFunctional Conservation
Human100%CompleteReference standard
Non-human primates>90%HighPresumed similar function
Rodents75-85%Moderate to highSome functional divergence
Other mammals70-80%ModerateVariable functionality
Non-mammals<70%Low to moderatePotentially different roles

This evolutionary pattern suggests that ANKRD46 likely serves conserved biological functions across mammals, with increasing divergence in more distant species.

What expression systems are most effective for producing recombinant human ANKRD46?

For successful expression of functional recombinant human ANKRD46, consider these methodological approaches:

  • Bacterial expression systems: While E. coli systems (BL21(DE3), Rosetta) provide high yields, they may require optimization for proper folding of ankyrin repeat structures. Use chaperone co-expression (GroEL/GroES) and lower induction temperatures (16-20°C) to improve folding.

  • Eukaryotic expression systems: HEK293 or CHO cells typically yield properly folded ANKRD46 with appropriate post-translational modifications. These systems are preferable when studying protein-protein interactions requiring mammalian modifications.

  • Expression tags optimization:

    • N-terminal tags (6xHis, GST) generally perform better than C-terminal tags

    • Include TEV protease cleavage sites for tag removal

    • Consider using SUMO fusion strategy to enhance solubility

  • Purification protocol:

    • Initial capture: Immobilized metal affinity chromatography (IMAC)

    • Intermediate purification: Ion exchange chromatography

    • Polishing: Size exclusion chromatography

    • Buffer optimization: Include 5-10% glycerol and 1-5 mM DTT to enhance stability

What are the most reliable approaches for studying ANKRD46 protein-protein interactions?

Given that ankyrin repeat domains primarily function as scaffolds for protein-protein interactions, several complementary methods should be employed:

  • Co-immunoprecipitation (Co-IP): Use epitope-tagged ANKRD46 (HA, FLAG, or V5) in cellular lysates, followed by western blot analysis to detect interacting partners.

  • Yeast two-hybrid screening: Effective for initial identification of potential interacting partners, though requires validation through other methods.

  • Pull-down assays: Utilize purified recombinant ANKRD46 as bait to identify interacting proteins from cell lysates.

  • Proximity labeling techniques: BioID or APEX2 fusion constructs can identify proximal proteins in living cells.

  • Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC): For quantitative measurement of binding affinities and kinetics.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): To map interaction surfaces within the ankyrin repeat domains.

The combination of multiple approaches provides the most comprehensive and reliable characterization of ANKRD46 interactome.

What techniques are most appropriate for analyzing ANKRD46 subcellular localization?

To accurately determine ANKRD46 subcellular localization:

  • Immunofluorescence microscopy: Use specific antibodies against ANKRD46 or epitope tags in fixed cells, with co-staining for organelle markers.

  • Cell fractionation: Perform biochemical separation of cellular compartments followed by western blot analysis.

  • Live-cell imaging: Express ANKRD46 fused to fluorescent proteins (GFP, mCherry) to track dynamic localization.

  • Super-resolution microscopy techniques: STORM or PALM provide nanometer-scale resolution for precise localization.

  • Electron microscopy with immunogold labeling: For highest resolution analysis of subcellular distribution.

When interpreting results, consider that overexpression systems may lead to artifacts, so validation with endogenous protein detection is crucial.

How does ANKRD46 contribute to the ubiquitylation signaling pathway?

Many ankyrin repeat-containing proteins participate in the ubiquitylation signaling pathway (USP) . For ANKRD46:

  • Mechanism assessment: Unlike some ANKRD family members (e.g., ANKRD13D), ANKRD46 does not contain the ubiquitin-interacting motif (UIM) . Its role in ubiquitylation likely involves:

    • Acting as a scaffold for E3 ligase complexes

    • Recruiting specific substrates for ubiquitylation

    • Stabilizing protein complexes involved in ubiquitin transfer

  • Experimental approaches:

    • Ubiquitylation assays with recombinant components

    • Immunoprecipitation followed by ubiquitin western blot

    • Mass spectrometry to identify ubiquitylation sites

    • Proteasome inhibitor treatments to assess protein stability

  • Functional implications: Given its correlation with good prognosis in RCC , ANKRD46 may regulate the stability of tumor suppressors or oncoproteins through the ubiquitin-proteasome system.

What is the relationship between ANKRD46 expression and cancer prognosis?

Based on survival analysis data:

  • Expression correlation: ANKRD46 overexpression correlates with good prognosis in renal cell carcinoma, unlike other ANKRD family members (ANKRD9, ANKRD10, and ANKRD13D) that correlate with poor prognosis .

  • Mechanistic basis:

    • Potential regulation of tumor suppressor pathways

    • Possible modulation of immune cell infiltration in the tumor microenvironment

    • May counteract the effects of negative prognostic ANKRD family members

  • Methodological considerations for prognosis studies:

    • Use multiple patient cohorts for validation

    • Control for confounding variables (stage, grade, treatment)

    • Perform multivariate analysis to assess independent prognostic value

    • Validate at both mRNA and protein levels

  • Comparison with other ANKRD proteins:

ANKRD ProteinExpression in RCCPrognosis CorrelationPotential Mechanism
ANKRD46VariableGoodCurrently under investigation
ANKRD9LowPoorUnknown
ANKRD10LowPoorUnknown
ANKRD13DHighPoorUIM-mediated interactions
ANKRD29VariableGood (in lung cancer)Unknown
ANKRD22VariablePoorE2F1 up-regulation; Wnt/β-catenin pathway activation

How can CRISPR-Cas9 gene editing be optimized for studying ANKRD46 function?

For effective CRISPR-Cas9 manipulation of ANKRD46:

  • Guide RNA design considerations:

    • Target conserved exons encoding ankyrin repeat domains

    • Design multiple gRNAs (minimum 3-4) targeting different regions

    • Verify low off-target scores using algorithms like CRISPOR or CHOPCHOP

    • Consider using paired nickase approach for increased specificity

  • Knock-out versus knock-in strategies:

    • Complete knock-out: Use gRNAs targeting early exons to create frameshift mutations

    • Domain-specific mutations: HDR-mediated knock-in to modify specific ankyrin repeats

    • Tagged versions: Insert epitope tags or fluorescent proteins for tracking

  • Validation approaches:

    • Genomic verification: PCR and sequencing to confirm edits

    • Transcript analysis: RT-PCR and RNA-seq to detect splice variants

    • Protein verification: Western blot to confirm protein absence or modification

    • Functional assays: Based on predicted ANKRD46 functions

  • Phenotypic analysis:

    • Cell proliferation and survival assays

    • Protein-protein interaction studies

    • Ubiquitylation pathway analysis

    • Cancer-related phenotypes (migration, invasion, anchorage-independent growth)

How can the structural determinants of ANKRD46 specificity be mapped for rational drug design?

Mapping the structural determinants requires:

  • High-resolution structural analysis:

    • X-ray crystallography of purified ANKRD46 (challenging due to flexibility)

    • Cryo-EM for structural determination in complex with binding partners

    • NMR for dynamics studies of isolated ankyrin repeat domains

    • Computational modeling using AlphaFold2 or RoseTTAFold as starting models

  • Structure-function analysis:

    • Alanine scanning mutagenesis of surface residues

    • Domain swapping with other ANKRD proteins

    • Creation of chimeric proteins to map specific interaction regions

    • Directed evolution approaches to identify critical residues

  • Binding interface characterization:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

    • Cross-linking mass spectrometry (XL-MS)

    • Molecular dynamics simulations of protein-protein interactions

  • Drug design strategy:

    • Fragment-based screening against defined interaction surfaces

    • Structure-based virtual screening of compound libraries

    • Peptidomimetic approaches targeting key interaction motifs

    • Protein-protein interaction disruptors (small molecules, peptides, macrocycles)

What methodological considerations are critical when investigating ANKRD46 in immune modulation?

Given the correlation between some ANKRD family members and immune checkpoint markers , investigating ANKRD46 in immune modulation requires:

  • Experimental systems selection:

    • In vitro co-culture systems with immune and cancer cells

    • Ex vivo analysis of patient-derived samples

    • Syngeneic mouse models with immunocompetent background

    • Humanized mouse models for human-specific interactions

  • Immune profiling approaches:

    • Flow cytometry for immune cell population analysis

    • Single-cell RNA sequencing to capture heterogeneity

    • Spatial transcriptomics/proteomics to maintain tissue context

    • Cytokine profiling using multiplex assays

  • Functional assays:

    • T cell activation and exhaustion marker analysis

    • Cytotoxicity assays with ANKRD46-modified target cells

    • Immune checkpoint blockade response in ANKRD46-high vs. low contexts

    • Macrophage polarization and function assessment

  • Correlative analyses:

    • ANKRD46 expression versus immune infiltration patterns

    • Relationship to immune checkpoint molecules (PDCD1, CTLA4, LAG3)

    • Association with inflammatory signaling pathways

    • Impact on response to immunotherapies

How do post-translational modifications affect ANKRD46 function and stability?

Understanding ANKRD46 post-translational modifications (PTMs) requires:

  • PTM identification strategies:

    • Mass spectrometry-based proteomics (phosphoproteomics, ubiquitylomics)

    • Site-specific antibodies for common modifications

    • In vitro modification assays with purified enzymes

    • PTM prediction algorithms followed by experimental validation

  • Common PTMs to investigate:

    • Phosphorylation: Affecting protein-protein interactions and localization

    • Ubiquitylation: Regulating protein stability and turnover

    • SUMOylation: Modifying protein localization and interactions

    • Acetylation: Altering protein function and complex formation

  • Functional impact assessment:

    • Site-directed mutagenesis of modified residues

    • Phosphomimetic and phosphodeficient mutations

    • Treatment with kinase inhibitors or phosphatase inhibitors

    • Cell cycle synchronization to capture dynamic modifications

  • PTM crosstalk analysis:

    • Sequential immunoprecipitation approaches

    • Multi-modal mass spectrometry

    • Targeted proteomics for specific modification combinations

    • Computational modeling of modification networks

How can inconsistent results in ANKRD46 expression studies be reconciled?

Discrepancies in ANKRD46 expression data may arise from:

  • Technical variables:

    • Different antibody specificities and epitopes

    • Variations in RNA extraction and reverse transcription efficiency

    • Primer design differences affecting splice variant detection

    • Normalization method selection (housekeeping genes versus global normalization)

  • Recommended standardization approaches:

    • Use multiple detection methods (qPCR, western blot, immunohistochemistry)

    • Include appropriate positive and negative controls

    • Validate commercial antibodies with CRISPR knockout controls

    • Document specific methodologies in detail for reproducibility

  • Biological variables consideration:

    • Cell type-specific expression patterns

    • Microenvironmental influences on expression

    • Disease stage and heterogeneity effects

    • Genetic background differences between cohorts

  • Data integration strategies:

    • Meta-analysis of multiple datasets

    • Classification of samples by molecular subtypes

    • Multivariate analysis to identify confounding factors

    • Single-cell approaches to resolve heterogeneity

What are the key considerations when designing inhibitors or activators targeting ANKRD46?

For developing ANKRD46-targeting compounds:

  • Target site selection criteria:

    • Protein-protein interaction surfaces versus allosteric sites

    • Conserved versus variable regions within ankyrin repeats

    • Sites with known functional relevance

    • Druggability assessment based on structural features

  • Screening approach selection:

    • Biochemical assays: FRET, AlphaScreen, FP for interaction disruption

    • Cellular assays: Reporter systems, phenotypic screens

    • Fragment-based screening by NMR or X-ray crystallography

    • In silico screening followed by experimental validation

  • Compound optimization considerations:

    • Structure-activity relationship (SAR) studies

    • ADME properties optimization

    • Off-target effects assessment against other ANKRD family members

    • Cellular permeability and target engagement confirmation

  • Validation requirements:

    • Target engagement in cellular context

    • Selectivity profiling against related proteins

    • Activity in disease-relevant models

    • Combination studies with established therapeutic agents

How should researchers address conflicting data regarding ANKRD46 function in different cancer types?

To resolve conflicting functional data:

  • Context-dependent analysis framework:

    • Systematic comparison across cancer types and subtypes

    • Cell lineage-specific pathway analysis

    • Genetic background characterization (mutations, CNVs)

    • Microenvironmental factor consideration

  • Technical approach standardization:

    • Consistent methodologies across comparative studies

    • Use of multiple cell lines representing each cancer type

    • Patient-derived models to capture disease heterogeneity

    • Dual in vitro and in vivo validation

  • Multiomics integration:

    • Correlation of genomic, transcriptomic, and proteomic data

    • Pathway analysis to identify context-specific networks

    • Epigenetic profiling to understand regulatory differences

    • Metabolomic analysis for functional outcomes

  • Systematic review approach:

    • Formal meta-analysis of published studies

    • Publication bias assessment

    • Sensitivity analysis based on methodology quality

    • Consensus development through expert panel review

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.