Recombinant Human Antigen-presenting glycoprotein CD1d (CD1D)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks. We will accommodate your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees will apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Antigen-presenting glycoprotein CD1d; CD1.1; CD1A; CD1d; CD1D antigen; CD1D antigen d polypeptide; CD1d molecule; CD1D_HUMAN; Cd1d1 ; differentiation antigen CD1 alpha 3 ; HMC class I antigen like glycoprotein CD1D ; Ly 38; MGC34622; R3; R3G1; T cell surface glycoprotein CD1d ; Thymocyte antigen CD1D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-335
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
EVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWGGSYTSMGLIALAVLACLLFLLIVGFTSRFKRQTSYQGVL
Uniprot No.

Target Background

Function
CD1d is an antigen-presenting protein that binds both self and non-self glycolipids, presenting them to the T-cell receptors on natural killer T cells.
Gene References Into Functions

CD1d's involvement in various biological processes is supported by extensive research:

  1. CD1d expression correlates with breast cancer progression and viability. (PMID: 28633979)
  2. CD1d plays a role in chronic lymphocytic leukemia progression and survival, potentially interacting with CD161. (PMID: 27385215)
  3. CD1d-expressing cells from allogeneic hematopoietic stem cell transplantation patients exhibit T cell suppressive activity and increased MyD88 and IDO expression. (PMID: 29108995)
  4. VP22 is necessary, but not sufficient, for inhibiting CD1d-mediated antigen presentation in herpes simplex virus type 1 infection. (PMID: 27327902)
  5. TLR4 ligation decreases FasL expression in splenic CD5(+)CD1d(hi) B cells. (PMID: 28505514)
  6. CD1d expression negatively correlates with CD86 levels in B cells from imiquimod (IMQ)-treated mice, B6.MRLlpr mice, and lupus erythematosus (SLE) patients. (PMID: 28338767)
  7. CD1d is implicated in CD1d-restricted peripheral T cell lymphoma in mice and humans. (PMID: 27069116)
  8. BCR-ABL-dependent ROCK, but not TK, is involved in CD1d downregulation in chronic myeloid leukemia (CML), suggesting ROCK's role in immune subversion. (PMID: 27513300)
  9. In Chagas disease, CD1d expression correlates with double-negative T cell activation and impaired ventricular function. (PMID: 27368347)
  10. B cell presentation of NGcGM3 via CD1d drives invariant natural killer T cell (iNKT) activation. (PMID: 26969612)
  11. CD1d distribution on antigen-presenting cells modulates iNKT cell activation. (PMID: 26798067)
  12. Both membrane-bound (V4) and soluble (V5) CD1d isoforms are overexpressed in gastric tumors, suggesting involvement in anti-tumor immunity. (PMID: 26119195)
  13. CD1d exhibits greater polymorphism than previously recognized. (PMID: 26041373)
  14. STAT3 signaling promotes CD1d-driven innate immune responses by regulating CD1d-mediated lipid antigen presentation. (PMID: 26260288)
  15. CD1d acts as a cell surface receptor for oxysterols, linking oxysterol binding to PPARγ activation. (PMID: 25618030)
  16. Staphylococcal enterotoxin B directly conjugates to CD1d. (PMID: 25649790)
  17. High CD1d expression is associated with medulloblastomas. (PMID: 25115738)
  18. Ets1 and miR-155 directly regulate CD1d expression on B cells. (PMID: 25929465)
  19. Phosphorylation of KIF3A is the primary mechanism for herpes simplex virus 1 US3-mediated CD1d downregulation. (PMID: 25878107)
  20. Simplexide activates iNKT cells and induces cytokine/chemokine production from human monocytes via CD1d interaction. (PMID: 25390653)
  21. CD1d expression in renal cell carcinoma correlates with aggressive disease and poor clinical outcomes. (PMID: 25477528)
  22. Alphabeta and gammadeltaTCR gene loci components recombine to confer antigenic specificity. (PMID: 25452463)
  23. B cell CD1d expression suggests antigen presentation to and interaction with iNKT cells (Review). (PMID: 25381357)
  24. CEACAM5, CD1d, and CD8 interactions may make CD1d more class I-like, facilitating antigen presentation and CD8(+)-suppressor regulatory T cell activation. (PMID: 24104458)
  25. CD1d expression varies in chronic lymphocytic leukemia (CLL), with high expression correlating with shorter time to treatment and overall survival. (PMID: 23668820)
  26. HCMV US2 interacts with hCD1d in the ER, contributing to immune evasion against iNKT cells. (PMID: 24213674)
  27. CXCL16, Valpha24, and CD1d are upregulated in eosinophilic esophagitis (EoE) and correlate with inflammatory mediators. (PMID: 24513807)
  28. High CD1d expression correlates with shorter time to treatment and overall survival in CLL, with expression changing over time. (PMID: 24418751)
  29. MHC class I associates with CD1d and regulates its surface expression. (PMID: 24009709)
  30. Findings provide insights into CD1d gene expression regulation, impacting CD1d and type I NKT cell evolution. (PMID: 24307737)
  31. CD1d is selectively expressed on hepatocytes in chronic hepatitis C. (PMID: 23808994)
  32. The gamma-delta TCR interacts with CD1d, with Vdelta1 and CDR1d loops dominating the interaction. (PMID: 24076636)
  33. T322 and S323 form a dual residue motif regulating CD1d expression during viral infection. (PMID: 23710894)
  34. Pollen lipid treatment upregulates CD1d in dendritic cells, activating iNKT cells. (PMID: 23265858)
  35. Type II NKT cell selection is dependent on thymic CD1d expression. CD1d traffics between the cell surface and endosomes, presenting lipid and mycobacterial antigens (Review). (PMID: 23468111)
  36. An autoreactive, CD1d-restricted, GPI-specific T-cell population is expanded in paroxysmal nocturnal hemoglobinuria and may cause bone marrow failure. (PMID: 23372165)
  37. Keratinocyte antigen presentation to iNKT cells shows that resting iNKT cells don't activate cytotoxicity effector genes, but can be targets for activated iNKT cells, depending on CD1d expression. (PMID: 23171451)
  38. CD1d protein structure determines the species-selective antigenicity of iGb3 to iNKT cells. (PMID: 23280365)
  39. CD1d expression (negative prognostic marker) correlates with soluble CTLA-4 in B-ALL patients. (PMID: 23049754)
  40. Crystallographic and biophysical analyses of alpha-GalCer recognition by a human CD1d-restricted TCR. (PMID: 23109910)
  41. Recombinant Vdelta1 TCRs bind recombinant CD1d-sulfatide complexes in a sulfatide-specific manner. (PMID: 22829134)
  42. Human and mouse type I NKT cell antigen receptors show different specificities for CD1d-antigen complexes. (PMID: 22995911)
  43. Histone deacetylase inhibitors increase Sp1 binding to the CD1d promoter and histone H3 acetylation at Sp1 sites. (PMID: 22419072)
  44. Insights into lysophospholipid presentation by human CD1d and its recognition by human iNKT cells. (PMID: 22395072)
  45. CD1d overexpression enhances immunostimulatory function of human embryonic stem cell-derived dendritic cells. (PMID: 22407918)
  46. Defective B cell stimulation of iNKT cells in SLE patients is linked to altered CD1d recycling. (PMID: 22406267)
  47. The serine-containing CD1d variant shows strong binding, explaining its prevalence in vivo. (PMID: 21956730)
  48. CD1d may modulate metabolic functions independently of iNKT cells. (PMID: 21980475)
  49. Phenyl glycolipids show higher binding avidity and stability for iNKT TCRs when complexed with CD1d. (PMID: 21987790)
  50. CD1d's potential role in lung mucosal immunity. (PMID: 21853044)
Database Links

HGNC: 1637

OMIM: 188410

KEGG: hsa:912

STRING: 9606.ENSP00000357153

UniGene: Hs.1799

Subcellular Location
Cell membrane; Single-pass type I membrane protein. Basolateral cell membrane; Single-pass type I membrane protein. Endosome membrane; Single-pass type I membrane protein. Lysosome membrane; Single-pass type I membrane protein. Endoplasmic reticulum membrane; Single-pass type I membrane protein.
Tissue Specificity
Expressed on cortical thymocytes, on certain T-cell leukemias, and in various other tissues.

Q&A

What is CD1d and how does it function in the immune system?

CD1d is a non-polymorphic MHC class I-like protein that associates with β2-microglobulin. Unlike classical MHC molecules that present peptide antigens, CD1d specializes in presenting phospholipid and glycosphingolipid antigens to invariant Natural Killer T (iNKT) cells, a specific subset of CD1d-restricted T cells . The CD1d-iNKT cell axis serves as a critical bridge between innate and adaptive immune responses, regulating nearly all aspects of both immune pathways . Upon activation through CD1d-presented antigens, iNKT cells can assume various functional profiles (Th1, Th2, or Th17) and directly exhibit cytotoxicity. This interaction plays significant roles in antimicrobial defense, antitumor immunity, and autoimmune regulation . CD1d thus represents a unique antigen presentation system that complements the classical MHC-restricted T cell activation pathways.

Where is CD1d expressed in the body and how is its expression regulated?

CD1d exhibits a broad expression pattern across multiple cell types, reflecting its significant immunological role. It is expressed on cells of multiple hematopoietic lineages, including both myeloid and lymphoid cells, such as B cells, T cells, macrophages, and dendritic cells . Additionally, CD1d is found on epithelial and vascular smooth muscle cells, indicating functions beyond immune cell interactions . The regulation of CD1d expression involves multiple transcription factors, with different mechanisms controlling expression in humans versus mice. In humans, transcription factors TFSP1 and LEF-1 play key regulatory roles, while in mice, members of the ETS family are primarily involved . This tissue-specific regulation of CD1d expression is critically important for the proper development and function of iNKT cells, establishing a narrow window between positive and negative selection to ensure optimal iNKT cell output . The distinct CD1d expression pattern appears to be evolutionarily selected to balance these selection processes.

What types of antigens are presented by CD1d molecules?

CD1d molecules present a diverse array of lipid antigens, both endogenous and exogenous. These presentable antigens include bacterial glycolipids derived from pathogens, marine sponge-derived α-galactosylceramide (α-GalCer, which serves as a prototypical CD1d agonist), normal endogenous glycolipids, and glycolipids and phospholipids derived from tumors . Notably, some non-lipidic molecules can also be presented by CD1d, though lipids represent the primary class of antigens . The presentation process involves CD1d internalization and trafficking through lysosomal and endosomal compartments, where the molecules exchange their ligands with various glycolipids before returning to the cell surface . This lipid exchange mechanism allows CD1d to sample and present lipids from various cellular and environmental sources. Once at the surface, CD1d-lipid complexes can interact with the T cell receptors of iNKT cells, initiating immune responses that vary depending on the specific lipid being presented .

How do differences between human and mouse CD1d impact translational research?

Despite the high degree of conservation between human and mouse CD1d systems, subtle but important differences exist that significantly impact translational research. These differences may explain the disparity between the powerful antitumor effects observed in conventional mouse models and the minimal success of NKT cell-based antitumor therapies in human clinical trials . The human CD1d knock-in mouse model demonstrates that replacement of mouse CD1d with human CD1d selects for a population of iNKT cells that more closely resembles human iNKT cells in both abundance and phenotype . In these mice, reduced numbers of iNKT cells are observed, similar to levels found in most normal humans. These iNKT cells predominantly express mouse Vβ8 (the homolog of human Vβ11) and phenotypically resemble human iNKT cells in their reduced expression of CD4 . Importantly, despite these differences, iNKT cells in human CD1d knock-in mice maintain potent antitumor functions in melanoma challenge models, suggesting that species-specific differences may be more related to iNKT cell development and selection rather than functional capacity .

How is CD1d expression altered in pathological conditions?

CD1d expression undergoes significant alterations in various pathological conditions, often serving as a mechanism of immune evasion. In viral infections, particularly EBV infection of B cells, CD1d expression can be modulated as part of viral immune evasion strategies . The HIV-1 viral protein U (Vpu) has been shown to down-regulate CD1d surface expression through mechanisms involving a C-terminal APW motif that is necessary for CD1d interference . This down-regulation is specific to CD1d and doesn't affect other Vpu functions such as CD4 down-regulation . In B cell malignancies, altered CD1d expression has both diagnostic and prognostic importance, potentially marking the developmental stage of transformed B cells . Autoimmune conditions also feature dysregulated CD1d expression, contributing to abnormal iNKT cell responses. These pathological alterations in CD1d expression can have significant functional consequences, as even moderate reductions in CD1d surface levels can diminish iNKT cell activation, impairing antimicrobial, antitumor, and autoimmune responses .

What strategies exist for labeling CD1d glycolipids to study their in vivo behavior?

Innovative labeling strategies have been developed to track CD1d-presented glycolipids in vivo without disrupting their functional properties. Analysis of crystal structures of the TCR-α-GalCer-CD1d ternary complex has identified the α-methylene unit in the fatty acid side chain, specifically the pro-S hydrogen at this position, as an optimal site for label incorporation . This strategic modification minimally impacts the TCR-glycolipid-CD1d ternary complex, allowing labeled molecules to function as effective mimics of the original CD1d agonists . Both biotinylated and fluorescently labeled versions of CD1d agonists have been successfully developed using this approach. Functional experiments have confirmed that the stereochemistry of labeling is critical, with substitution at the pro-S position being optimal for maintaining activity . Significantly, these labeled compounds display functional behavior comparable to their unlabeled counterparts while making the biotin residue available for streptavidin and antibiotin antibody recognition or enabling fluorescent tracking . The synthetic strategy allows for late-stage incorporation of various labels, making this approach highly versatile for studying different CD1d agonists.

How can CD1d tetramers be utilized to study iNKT cell populations?

CD1d tetramers represent powerful tools for detecting and characterizing CD1d-restricted NKT cells in research settings. These reagents are prepared by tetramerization of complexes of CD1d and β2-microglobulin using PE- or APC-labeled streptavidin . When loaded with α-galactosylceramide (α-GalCer), these tetramers enable highly sensitive detection of CD1d-restricted NKT cells . The methodology offers significant advantages over traditional techniques, as CD1d tetramers can be combined with antibodies to simultaneously study multiple aspects of NKT cell phenotype and function . For optimal results, researchers should consider factors such as the specific glycolipid loaded onto the tetramer, fluorophore selection based on experimental design, and appropriate controls to distinguish specific from non-specific binding. Additionally, the concentration and incubation conditions of tetramers must be optimized for each experimental system. The ability to precisely identify and characterize iNKT cell populations using CD1d tetramers has significantly advanced our understanding of these cells in both normal immune functions and disease states.

What approaches can be used to generate human CD1d knock-in models for translational research?

The generation of human CD1d knock-in (hCD1d-KI) mouse models provides valuable tools for more accurate in vivo modeling of human iNKT cell responses. These models are created by replacing mouse CD1d genes with their human counterparts, ensuring that hCD1d is expressed in a native tissue distribution pattern . The knock-in approach, rather than simple transgenic expression, maintains the proper regulation of CD1d expression across tissues. When generating these models, researchers must consider the role of regulatory elements to ensure physiologically relevant expression patterns. The resulting hCD1d-KI mice support NKT cell development, albeit with reduced numbers of iNKT cells that more accurately reflect human iNKT cell abundance . These iNKT cells predominantly express mouse Vβ8 (the homolog of human Vβ11) and show reduced CD4 expression, phenotypically resembling human iNKT cells . Importantly, functional testing has demonstrated that iNKT cells in these knock-in models maintain potent antitumor functions in challenge models, validating their utility for preclinical assessment of iNKT cell-targeted therapies .

How does cell type-specific CD1d expression impact iNKT cell development and function?

The level and pattern of CD1d expression across different cell types significantly impacts both the development and function of iNKT cells. Studies using transgenic mice expressing CD1d under the control of MHC class Ia promoters have revealed that cell type-specific CD1d surface density is crucial for proper selection of NKT cells . These experiments demonstrate that while MHC class Ia-like expression patterns and tissue distribution are insufficient for CD1d to rescue CD8+ T cell development, they can partially rescue the NKT cell compartment . This indicates that the unique structural features of CD1d, rather than just its expression pattern, determine its selective role in iNKT cell development. Importantly, increased CD1d expression on dendritic cells enhances negative selection of NKT cells, suggesting that a delicate balance of CD1d expression establishes a narrow window between positive and negative selection . This fine-tuning of CD1d expression across different cell types appears to be evolutionarily selected to ensure optimal iNKT cell output. Methodologically, researchers must consider these cell type-specific effects when designing experiments to study CD1d-iNKT cell interactions.

How does CD1d contribute to antimicrobial, antitumor, and autoimmune responses?

CD1d plays versatile roles in multiple immune responses through its presentation of lipid antigens to iNKT cells. In antimicrobial immunity, CD1d can present bacterial glycolipids directly to iNKT cells, triggering rapid cytokine responses that shape both innate and adaptive immunity against pathogens . This rapid response capability allows the immune system to mount effective defenses before conventional T cell responses fully develop. In antitumor immunity, CD1d-restricted iNKT cells can recognize tumor-derived glycolipids and phospholipids, leading to direct cytotoxicity against malignant cells and production of cytokines that enhance broader antitumor responses . This capability makes CD1d-iNKT cell interactions promising targets for cancer immunotherapy approaches. In autoimmune contexts, the CD1d-iNKT cell axis plays regulatory roles, with iNKT cells capable of producing both pro-inflammatory and anti-inflammatory cytokines that modulate self-reactive immune responses . Disruption of normal CD1d expression or function can contribute to dysregulated immune responses against self-tissues. These diverse roles highlight the centrality of CD1d in connecting innate and adaptive immune pathways across multiple disease contexts.

What strategies are being explored to target the CD1d-iNKT cell axis therapeutically?

Multiple therapeutic strategies targeting the CD1d-iNKT cell axis are under investigation for conditions including cancer, autoimmune disease, and infectious diseases. One prominent approach involves using synthetic CD1d ligands like α-galactosylceramide (α-GalCer) and its derivatives to activate iNKT cells in a controlled manner . These glycolipids can be modified to bias toward specific cytokine profiles, with some derivatives favoring Th1-type responses (beneficial for cancer) and others promoting Th2-type responses (useful in autoimmunity) . Another strategy involves engineered CD1d tetramers or fusion proteins that can target specific cell populations while activating iNKT cells in their vicinity . The development of human CD1d knock-in mouse models has facilitated more accurate preclinical assessment of these iNKT cell-targeted therapies by better recapitulating human iNKT cell responses . Researchers are also exploring approaches to modulate CD1d expression on specific cell types to enhance antigen presentation to iNKT cells. Additionally, combinatorial approaches that pair CD1d-iNKT cell activation with other immunotherapies, such as checkpoint inhibitors or tumor vaccines, show promise for enhancing therapeutic efficacy, particularly in cancer settings .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.