Recombinant Human AP20 region protein 1 (APRG1)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Human AP20 region protein 1 (APRG1) is a protein encoded by the APRG1 gene, which is located in the 3p21.3 region of chromosome 3 . The 3p21.3 region is known to be frequently deleted in epithelial malignancies, suggesting that it harbors multiple tumor suppressor genes . APRG1 is considered a candidate tumor suppressor gene .

Gene Information

The APRG1 gene (ENSG00000198590) is located on chromosome 3 at position 37,381,062-37,440,186 (forward strand) . The gene has 14 transcripts (splice variants) . Information related to APRG1 can be found in public databases such as HGNC (24082), OMIM (611429), KEGG (hsa:339883), STRING (9606.ENSP00000331625), and UniGene (Hs.475945) .

Protein Production

Recombinant Human APRG1 can be produced using an in vitro E. coli expression system .

Role in Cancer

APRG1 expression is lower in malignant tissues, with even lower expression in patients who develop progressive disease . A study analyzing 120 tumor tissues and 33 normal tissues found that APRG1 mRNA levels were lower in malignant tissues compared to normal tissues . The study also found that APRG1 expression was negatively correlated with progressive disease, such as metastasis or local recurrence . APRG1 levels were significantly reduced in grade 3 tumors compared to grade 1 tumors (p = 0.0081) .

Association with Other Genes

DDX3Y demonstrates a significant positive correlation with the expression of 15 genes, including HBD, BRPF3, ZNF177, and KCM1B, while showing an inverse correlation with the expression of 20 genes, including SEL1L1, GGT8P, AK4, and SCAMP4 .

Epigenetic Associations

Research has explored the epigenetic landscape and the impact of radiation exposure on aging processes, noting the involvement of APRG1 in these complex interactions . The study revealed that stress and age-related pathways, including senescence, myelination signaling, neuroinflammation, and IL-33 signaling pathways, overlap in all groups, suggesting a link to aging processes .

Data Tables

Table 1: APRG1 Expression in Tumor Tissues

Tissue TypeAPRG1 mRNA Levelsp-value
NormalHigherN/A
MalignantLowerN/A
TNM Stage 1Higher0.0046
TNM Stage 3 & 4Lower0.04
Grade 1Higher0.0081
Grade 3LowerN/A
No MetastasisHigher0.0069
Alive with MetastasisLower0.0055
No Local RecurrenceHigher0.11
Local RecurrenceLower0.035
Died of Breast CancerLower

Table 2: Differentially Expressed Transcripts

GeneDescription
APRG1APRG1 tumor suppressor candidate
DDX3YDEAD-Box Helicase 3 Y-Linked
HBDHemoglobin Subunit Delta
BRPF3BRPF3 Histone Acetyltransferase Complex Subunit
ZNF177Zinc Finger Protein 177
KCM1BPotassium Calcium-Activated Channel Subfamily M Regulatory Beta Subunit 1
SEL1L1SEL1L Adaptor Protein
GGT8PGamma-Glutamyltransferase 8 Pseudogene
AK4Adenylate Kinase 4
SCAMP4Secretory Carrier Membrane Protein 4

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in your order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
APRG1; C3orf35; APRG1 tumor suppressor candidate; AP20 region protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-170
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
APRG1
Target Protein Sequence
MKTMATRKRCKLSRTGPEFENVIKRLLCARTFHTRIGGDLTHGIINRGRRANAEQMGLQG SAQHFNIFPLDLWTQGKKTEVQKREGTDSIPAAGRSGTANQPSIAPHRCLFSRGITALDG LKRGRGCNGAAHLVRGDAWKTKLGEPWVSIALALAGPGAILILELSWFLG
Uniprot No.

Target Background

Gene References Into Functions
  1. Studies indicate a trend of lower APRG1 transcription in malignant tissues, particularly in patients with progressive disease and between grade I and III tumors. These findings suggest APRG1 may function as a tumor suppressor gene. PMID: 16187228
Database Links

HGNC: 24082

OMIM: 611429

KEGG: hsa:339883

STRING: 9606.ENSP00000331625

UniGene: Hs.475945

Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
[Isoform 1]: Expressed at high levels in the pancreas and placenta.; [Isoform 2]: Expressed at high levels in the kidney.

Q&A

What is APRG1 and what is its genomic location?

APRG1 is a gene located in the chromosome region 3p21.3, an area frequently deleted in epithelial malignancies. This region is thought to contain multiple tumor suppressor genes that exhibit specificity for different malignancy types . APRG1 encodes a protein that has been implicated in cell membrane interactions and appears to have tumor suppressive functions, particularly in breast cancer .

How is APRG1 expression typically measured in research studies?

Quantitative measurement of APRG1 expression is commonly performed using real-time quantitative PCR (qPCR). In research settings, APRG1 expression is typically normalized against housekeeping genes such as CK19, as demonstrated in studies examining its role in breast cancer . This normalization is crucial for accurate comparison across different tissue samples and experimental conditions.

What is the evidence for APRG1's role as a tumor suppressor?

Multiple lines of evidence support APRG1's function as a tumor suppressor gene:

  • APRG1 mRNA levels are consistently lower in malignant tissues compared to normal tissues

  • Expression levels decrease progressively with increasing cancer stage (TNM classification)

  • A statistically significant reduction in APRG1 expression is observed in grade 3 tumors compared to grade 1 tumors (p = 0.0081)

  • APRG1 expression is negatively correlated with progressive disease outcomes, including:

    • Metastasis development (p = 0.0069)

    • Local recurrence (p = 0.0055)

    • Death from breast cancer (p = 0.11)

    • All forms of progressive disease (p = 0.035)

What sample sizes are appropriate for APRG1 expression studies?

Based on published research, robust APRG1 expression studies typically require substantial sample sizes. A landmark study utilized 120 tumor tissues and 33 normal tissues to achieve statistical significance when correlating expression with clinical parameters . This sample size was sufficient to detect significant differences between cancer stages and grades, as well as correlation with disease progression.

What are the recommended protocols for APRG1 expression analysis in tissue samples?

When analyzing APRG1 expression in tissue samples, researchers should follow these methodological approaches:

  • Sample preparation: Ensure proper preservation of RNA integrity in tissue samples through immediate freezing or use of RNA stabilization reagents

  • RNA extraction: Use standardized methods that consistently yield high-quality RNA

  • qPCR analysis: Implement real-time quantitative PCR with appropriate primers specific to APRG1

  • Normalization: Normalize APRG1 expression against established housekeeping genes such as CK19

  • Statistical analysis: Compare expression levels across clinical parameters including staging, nodal involvement, grade, distant metastasis, and survival data

How should researchers control for variability in APRG1 expression studies?

To ensure reliable and reproducible results when studying APRG1 expression:

  • Include both tumor and matched normal tissues whenever possible

  • Use multiple technical replicates (at least triplicate) for each qPCR reaction

  • Include standardized positive and negative controls

  • Normalize expression data against multiple reference genes to control for variation

  • Account for potential confounding factors such as patient age, treatment history, and comorbidities

How does APRG1 relate to other tumor suppressor genes in the 3p21.3 region?

The 3p21.3 chromosomal region contains multiple tumor suppressor genes that are frequently deleted in various epithelial malignancies . While each gene in this region may have distinct functions, they likely participate in a coordinated tumor suppressive network. Unlike some related genes like APE1 (apurinic/apyrimidinic endonuclease 1), which has been shown to bind G-quadruplex structures and regulate gene expression in cancer cells , APRG1's precise molecular mechanism remains to be fully elucidated.

What are the challenges in developing recombinant APRG1 for functional studies?

Developing recombinant proteins for functional studies presents several challenges that researchers should consider:

  • Expression systems: Selection of appropriate prokaryotic or eukaryotic expression systems to ensure proper folding and post-translational modifications

  • Purification strategies: Design of efficient purification protocols that maintain protein structure and function

  • Functional validation: Confirmation that the recombinant protein retains native biological activity

  • Storage stability: Determination of optimal conditions for maintaining protein integrity during storage

Researchers can learn from approaches used with related proteins such as APLP-1, which has been successfully produced as a recombinant protein with a C-terminal 6-His tag .

How might APRG1 expression analysis be integrated with other cancer biomarkers?

Integrating APRG1 expression analysis with other cancer biomarkers could enhance its diagnostic and prognostic utility:

  • Multi-marker panels: Combine APRG1 with established breast cancer biomarkers (ER, PR, HER2, Ki-67)

  • Hierarchical clustering: Use bioinformatic approaches to identify patient subgroups based on APRG1 and other molecular markers

  • Pathway analysis: Integrate APRG1 expression data with other genes involved in related cellular pathways

  • Correlation studies: Analyze relationships between APRG1 and other potential tumor suppressors in the 3p21.3 region

How should researchers interpret APRG1 expression in relation to cancer progression?

When interpreting APRG1 expression data in cancer studies, researchers should consider:

  • Progressive decrease with stage: APRG1 levels decrease with increasing TNM stage, with statistically significant differences when comparing stages 3 and 4 to stage 1 (p = 0.0046, p = 0.04)

  • Correlation with grade: Lower expression correlates with higher tumor grade, with significant reduction in grade 3 compared to grade 1 tumors (p = 0.0081)

  • Association with outcomes: Lower expression levels correlate with poorer clinical outcomes, including metastasis, recurrence, and mortality

  • Threshold determination: Consider establishing clinically relevant threshold values that correlate with specific outcomes

What statistical approaches are most appropriate for analyzing APRG1 expression data?

Appropriate statistical methods for APRG1 expression analysis include:

  • Comparative analyses: t-tests or ANOVA for comparing expression levels between different groups (normal vs. malignant, different grades/stages)

  • Correlation analyses: Spearman or Pearson correlation to assess relationships between APRG1 expression and continuous variables

  • Survival analyses: Kaplan-Meier curves and log-rank tests to evaluate associations between APRG1 expression and patient outcomes

  • Multivariate models: Cox proportional hazards models to assess APRG1 as an independent prognostic factor while controlling for other variables

What mechanistic studies would advance understanding of APRG1's tumor suppressive function?

Several experimental approaches could illuminate APRG1's molecular mechanisms:

  • Gene editing studies: CRISPR/Cas9 knockout or knockdown experiments to examine effects on cell proliferation, migration, and invasion

  • Protein interaction studies: Immunoprecipitation followed by mass spectrometry to identify binding partners

  • Pathway analysis: RNA-seq or proteomics approaches to identify downstream effectors

  • In vivo models: Xenograft studies with APRG1-modulated cancer cells to assess effects on tumor growth and metastasis

How might APRG1-targeted therapies be developed for cancer treatment?

Potential therapeutic approaches targeting APRG1 could include:

  • Gene therapy: Restoration of APRG1 expression in tumors with reduced levels

  • Small molecule modulators: Development of compounds that enhance APRG1 expression or activity

  • Synthetic lethality: Identification of genes whose inhibition is selectively lethal in APRG1-deficient cells

  • Combination strategies: Integration of APRG1-targeted approaches with conventional therapies

What are the prospects for APRG1 as a prognostic or predictive biomarker?

Based on current evidence, APRG1 shows promise as a biomarker:

  • Prognostic value: The significant correlation between low APRG1 expression and poor outcomes suggests potential as a prognostic marker

  • Risk stratification: APRG1 levels could help identify high-risk patients who might benefit from more aggressive treatment

  • Therapy response prediction: Further studies needed to determine if APRG1 status predicts response to specific therapies

  • Integration potential: APRG1 could be incorporated into multi-marker panels for enhanced predictive power

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.