Recombinant Human Apolipoprotein L domain-containing protein 1 (APOLD1)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Vascular Biology

APOLD1 is an endothelial early-response protein regulating vascular homeostasis . Key findings include:

  • Endothelial junction integrity: APOLD1 localizes to cell-cell junctions and Weibel-Palade bodies (WPB), where it stabilizes von Willebrand factor (VWF) and angiopoietin-2 (ANGPT2) . Knockdown disrupts cytoskeletal architecture, increasing endothelial permeability .

  • WPB regulation: APOLD1 deficiency triggers spontaneous WPB exocytosis, elevating extracellular VWF and ANGPT2 levels .

  • Autophagy modulation: Silencing APOLD1 alters autophagic flux, promoting WPB secretion .

Table 2: Functional Impacts of APOLD1 Deficiency

ParameterAPOLD1-Knockdown Effects
Endothelial PermeabilityIncreased FITC-dextran leakage (40 kDa)
WPB ContentReduced intracellular VWF and ANGPT2 storage
AutophagyImpaired lysosomal fusion, leading to vacuolar WPB remnants

Research Applications

Recombinant APOLD1 is widely used in:

  • ELISA development: Commercial kits (e.g., KT-38747) detect APOLD1 in biological fluids (sensitivity: <0.112 ng/mL; range: 0.312–20 ng/mL) .

  • Antibody production: Monoclonal/polyclonal antibodies (e.g., Cloud-Clone, Atlas Antibodies) enable immunoassays and immunohistochemistry .

  • In vitro studies: Investigating endothelial dysfunction, autophagy, and vascular permeability .

Clinical Implications

APOLD1 dysregulation is linked to vascular pathologies:

  • Endothelial disorders: Loss of APOLD1 disrupts junctional integrity, suggesting a role in diseases like atherosclerosis .

  • Podocyte toxicity: APOLD1 variants (e.g., G1/G2) interact with cholesterol, contributing to nephropathy in inflammatory conditions .

  • Diagnostic potential: Elevated plasma VWF/ANGPT2 may serve as biomarkers for APOLD1-related endothelial dysfunction .

Future Directions

Research gaps include:

  • Mechanistic insights: How APOLD1 modulates autophagy-WPB crosstalk.

  • Therapeutic targeting: Small-molecule stabilizers of APOLD1 for vascular diseases.

  • Clinical validation: Correlating APOLD1 variants with endothelial dysfunction in patient cohorts.

Product Specs

Buffer
For liquid delivery, the default storage buffer is Tris/PBS-based, containing 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer used prior to lyophilization is Tris/PBS-based, with 6% Trehalose.
Form
Liquid or Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly specify them in your order notes, and we will fulfill your request.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tagged
Synonyms
APOLD1; VERGE; Apolipoprotein L domain-containing protein 1; Vascular early response gene protein
Datasheet & Coa
Please contact us to get it.
Expression Region
1-279aa
Mol. Weight
33.4 kDa
Protein Length
Full Length
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Cardiovascular
Source
in vitro E.coli expression system
Species
Homo sapiens (Human)
Target Names
APOLD1
Target Protein Sequence
MFRAPCHRLRARGTRKARAGAWRGCTFPCLGKGMERPAAREPHGPDALRRFQGLLLDRRGRLHGQVLRLREVARRLERLRRRSLVANVAGSSLSATGALAAIVGLSLSPVTLGTSLLVSAVGLGVATAGGAVTITSDLSLIFCNSRELRRVQEIAATCQDQMREILSCLEFFCRWQGCGDRQLLQCGRNASIALYNSVYFIVFFGSRGFLIPRRAEGDTKVSQAVLKAKIQKLAESLESCTGALDELSEQLESRVQLCTKSSRGHDLKISADQRAGLFF
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
Apolipoprotein L domain-containing protein 1 (APOLD1) may be involved in angiogenesis. It may play a role in activity-dependent changes in brain vasculature and potentially affect blood-brain permeability.
Database Links

HGNC: 25268

OMIM: 612456

KEGG: hsa:81575

STRING: 9606.ENSP00000324277

UniGene: Hs.23388

Protein Families
Apolipoprotein L family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in neonatal dermal microvascular endothelial cells.

Q&A

What is the basic structure and characteristics of recombinant human APOLD1?

Recombinant Human APOLD1 is a transmembrane protein with a molecular weight of approximately 33.4 kDa. When expressed in E. coli systems, the protein typically spans amino acid regions 1-279 and carries an N-terminal 10xHis tag for purification and detection purposes . APOLD1 belongs to the broader apolipoprotein L family, which are mammalian lipid-interacting proteins encoded by rapidly evolving multigene families and expressed at various levels across all organs . As a member of this family, APOLD1 contains characteristic apolipoprotein L domains that facilitate interaction with lipid membranes.

How does APOLD1 compare structurally with other apolipoprotein L family members?

While APOLD1 shares the apolipoprotein L domain with other family members, it exhibits distinct functional properties. Unlike the well-characterized APOL1 and APOL3 proteins that have defined roles in membrane dynamics and intracellular trafficking, APOLD1 is primarily localized to endothelial cell contacts and Weibel-Palade bodies (WPBs) . APOLD1 appears to have evolved specialized functions in vascular biology, particularly in angiogenesis and endothelial cell regulation, distinguishing it from other family members that may have more diverse roles across different tissue types .

What are the primary cellular localizations of APOLD1 and their functional significance?

Immunolocalization studies have revealed that APOLD1 is predominantly found in:

  • Endothelial cell junctions: APOLD1 localizes to cell contacts where it appears to regulate the cell junction-cytoskeletal interface

  • Weibel-Palade bodies (WPBs): Within these specialized secretory organelles, APOLD1 associates with von Willebrand factor (VWF) tubules

This dual localization suggests APOLD1 plays critical roles in both maintaining endothelial cell barrier integrity and regulating the storage and release of important hemostatic and inflammatory mediators from WPBs. The protein's presence at these key cellular sites positions it as a multifunctional regulator of vascular homeostasis .

How does APOLD1 regulate endothelial permeability?

APOLD1 is a critical regulator of endothelial barrier function through its effects on the cell junction-cytoskeletal interface. Research using silencing techniques has demonstrated that APOLD1 depletion disrupts this interface, leading to altered endothelial permeability . Mechanistically, APOLD1 appears to:

  • Stabilize intercellular junctions between endothelial cells

  • Maintain proper cytoskeletal architecture that supports barrier function

  • Regulate the controlled release of Weibel-Palade body contents that can influence permeability

When APOLD1 function is compromised, these regulatory mechanisms are disrupted, resulting in increased vascular leakage. This understanding provides insight into how APOLD1 contributes to maintaining vascular integrity under normal physiological conditions .

What is the relationship between APOLD1 and Weibel-Palade bodies?

APOLD1 has been localized to Weibel-Palade bodies (WPBs), specialized secretory organelles in endothelial cells that store and release von Willebrand factor (VWF) and other vasoactive substances. Within WPBs, APOLD1 physically associates with VWF tubules, suggesting a direct interaction with this critical hemostatic protein .

Functional studies show that APOLD1 silencing results in:

  • Spontaneous release of WPB contents

  • Increased extracellular levels of VWF and angiopoietin-2 (ANGPT2)

  • Impaired autophagy flux, which is essential for the regulated release of WPBs

These findings position APOLD1 as a key regulator of WPB exocytosis, controlling when and how these important secretory granules release their contents to influence vascular function .

How does APOLD1 contribute to angiogenesis processes?

APOLD1 functions as an endothelial immediate early gene involved in regulating vascular development and remodeling. While the exact molecular mechanisms remain under investigation, research indicates that APOLD1 likely:

  • Regulates endothelial cell proliferation and migration during new vessel formation

  • Modulates the response to angiogenic growth factors

  • Contributes to proper vessel maturation through effects on endothelial junctions

  • Coordinates the release of angiogenic regulators from Weibel-Palade bodies

The identification of APOLD1's role in angiogenesis suggests it may be a potential therapeutic target for conditions characterized by abnormal blood vessel formation or function .

What are the recommended methods for detecting APOLD1 expression in different cell types?

For comprehensive APOLD1 detection across different cell types, researchers should employ a multi-technique approach:

Protein Detection:

  • Western blotting using validated anti-APOLD1 antibodies (typically targeting the N-terminal region)

  • Immunofluorescence microscopy to visualize cellular localization, particularly at endothelial junctions and Weibel-Palade bodies

  • Flow cytometry for quantitative analysis in heterogeneous cell populations

mRNA Detection:

  • Quantitative RT-PCR using primers specific to APOLD1 conserved regions

  • RNA-seq for transcriptome-wide analysis of expression patterns

  • In situ hybridization for tissue-specific localization studies

For recombinant APOLD1, detection can be facilitated by the N-terminal 10xHis tag using anti-His antibodies . When studying endothelial cells specifically, co-staining with VWF and junction markers (VE-cadherin, PECAM-1) can help confirm proper localization patterns .

What experimental approaches are most effective for studying APOLD1 function in endothelial cells?

Several complementary approaches have proven effective for investigating APOLD1 function in endothelial cells:

Loss-of-Function Studies:

  • siRNA or shRNA-mediated silencing in primary human endothelial cells

  • CRISPR-Cas9 gene editing for complete knockout models

  • Expression of dominant-negative mutants (e.g., APOLD1:p.R49*)

Functional Assays:

  • In vitro permeability assays using fluorescent dextrans or electrical impedance

  • VWF and angiopoietin ELISA to quantify WPB secretion

  • Autophagy flux assessment using LC3-II/LC3-I ratios and p62 accumulation

  • Cell junction integrity evaluation via immunofluorescence

Advanced Imaging:

  • Live-cell imaging to track WPB exocytosis events

  • Super-resolution microscopy to visualize APOLD1 association with VWF tubules

  • Electron microscopy for ultrastructural analysis of WPBs and cell junctions

These methodologies collectively provide comprehensive insights into APOLD1's multifaceted roles in endothelial biology.

What are the key considerations when using recombinant APOLD1 in experimental systems?

When utilizing recombinant APOLD1 in research applications, several important factors should be considered:

Protein Properties:

  • Purity: Ensure >85% purity as determined by SDS-PAGE to minimize interference from contaminants

  • Tag influence: The N-terminal 10xHis tag may affect certain protein interactions or functions

  • Storage conditions: Maintain appropriate buffer conditions to preserve protein stability and activity

Experimental Design:

  • Physiological relevance: Use concentrations that approximate endogenous levels

  • Cell type selection: Primary human endothelial cells are preferred for functional studies

  • Controls: Include appropriate tag-only controls to distinguish tag versus APOLD1-specific effects

Technical Limitations:

  • Transmembrane nature: The transmembrane domain may affect solubility and handling

  • Potential for aggregation: Monitor for aggregation that could impact functional assays

  • Endotoxin contamination: For inflammation studies, ensure endotoxin levels are tested and controlled

What is known about APOLD1 mutations and their association with human diseases?

Research has identified APOLD1 mutations associated with a novel inherited bleeding disorder characterized by:

  • Atypical bleeding diathesis

  • Episodic impaired microcirculation

  • Autosomal dominant inheritance pattern

Most notably, a dominant heterozygous nonsense mutation (APOLD1:p.R49*) has been documented in affected family members across three generations of a large family. This mutation results from the combination of a common variant and a rare adjacent nucleotide substitution in cis .

The pathological mechanisms appear to involve:

  • Compromised vascular integrity due to excess plasma angiopoietin-2 (ANGPT2)

  • Locally impaired availability of von Willebrand factor

  • Disrupted endothelial cell junction stability

These findings indicate that APOLD1 should be considered as a candidate gene in patients with inherited bleeding disorders without apparent platelet or coagulation defects .

How does APOLD1 dysfunction contribute to vascular pathology?

APOLD1 dysfunction contributes to vascular pathology through several interconnected mechanisms:

Barrier Dysfunction:

  • Disruption of endothelial cell junctions leads to increased vascular permeability

  • Altered cytoskeletal architecture compromises mechanical stability

  • Excessive leakage of plasma components can cause tissue edema and inflammation

Dysregulated WPB Exocytosis:

  • Spontaneous release of WPB contents, including VWF and ANGPT2

  • Impaired autophagy flux, which normally regulates WPB release

  • Altered balance of pro- and anti-inflammatory mediators in the circulation

Hemostatic Abnormalities:

  • Impaired VWF availability at sites of vascular injury

  • Disrupted platelet adhesion and aggregation

  • Increased tendency for bleeding manifestations

These pathological processes highlight the importance of APOLD1 in maintaining vascular homeostasis and suggest multiple potential intervention points for therapeutic strategies.

How might targeting APOLD1 be therapeutically relevant for vascular disorders?

Based on current understanding of APOLD1 functions, several therapeutic strategies could be developed:

For APOLD1 Deficiency Disorders:

  • Gene therapy approaches to restore functional APOLD1 expression

  • Small molecule stabilizers of endothelial junctions to compensate for APOLD1 loss

  • Modulators of WPB exocytosis to prevent inappropriate release of contents

  • ANGPT2 antagonists to counter excessive angiopoietin-2 signaling

For Conditions with Excessive APOLD1 Activity:

  • Targeted inhibition using specific antibodies or aptamers

  • Small molecule inhibitors of APOLD1-dependent pathways

  • miRNA-based approaches to downregulate APOLD1 expression

The therapeutic potential of targeting APOLD1 extends to various vascular conditions including:

  • Inherited bleeding disorders

  • Vascular leak syndromes

  • Inflammatory vascular diseases

  • Disorders of abnormal angiogenesis

What is the relationship between APOLD1 and autophagy regulation in endothelial cells?

The relationship between APOLD1 and autophagy in endothelial cells represents a complex regulatory mechanism:

APOLD1 silencing has been shown to impair autophagy flux, which is essential for the regulated release of Weibel-Palade bodies (WPBs) . This suggests APOLD1 plays a critical role in coordinating autophagy-dependent vesicular trafficking pathways in endothelial cells.

Potential Mechanisms:

  • APOLD1 may regulate autophagosome formation or maturation through interaction with autophagy machinery

  • APOLD1's localization at cell junctions might coordinate cytoskeletal rearrangements necessary for autophagosome trafficking

  • The protein's association with WPBs may facilitate selective autophagy of these specialized secretory granules

Understanding this relationship could provide insights into how cellular stress responses and secretory pathways are integrated in endothelial cells, with implications for both normal physiology and pathological conditions affecting vascular function .

How do the functions of APOLD1 differ from or interact with other apolipoprotein L family members in the vascular system?

While APOLD1 shares structural features with other apolipoprotein L family members, its functions in the vascular system appear distinct:

Comparative Functions:

  • APOLD1: Primarily regulates endothelial cell junctions, WPB secretion, and vascular integrity

  • APOL1: More involved in inflammation-linked vesicular trafficking and podocyte function

  • APOL3: Functions in membrane fusion, fission, and Golgi trafficking

Potential Interactions:

  • The apolipoprotein L family members may cooperate in coordinating membrane remodeling events in vascular cells

  • They may have complementary roles in response to inflammatory signals

  • Different family members might be preferentially activated under specific pathophysiological conditions

Research suggests that unlike APOL1, which has specific roles in trypanosome resistance and kidney disease, APOLD1 appears more specialized for vascular biology and homeostasis. Further studies are needed to fully elucidate how these family members function independently and cooperatively in the vascular system .

What advanced imaging techniques are being developed to visualize APOLD1 dynamics in live endothelial cells?

Cutting-edge imaging approaches are enhancing our ability to study APOLD1 dynamics in living endothelial cells:

Super-Resolution Microscopy:

  • Stimulated emission depletion (STED) microscopy allows visualization of APOLD1 at endothelial junctions with resolution below the diffraction limit

  • Single-molecule localization microscopy (PALM/STORM) enables precise mapping of APOLD1 molecules relative to junction proteins and WPB components

Live-Cell Imaging Strategies:

  • APOLD1-fluorescent protein fusions (e.g., APOLD1-GFP) for real-time tracking

  • Photo-activatable or photo-convertible tags to monitor protein movement between cellular compartments

  • FRET-based biosensors to detect APOLD1 conformational changes or protein-protein interactions

Correlative Light and Electron Microscopy (CLEM):

  • Combines fluorescence imaging of tagged APOLD1 with ultrastructural detail from electron microscopy

  • Particularly valuable for visualizing APOLD1's association with WPB membranes and VWF tubules

These advanced techniques are revealing dynamic aspects of APOLD1 biology that were previously inaccessible, including real-time trafficking, response to vascular stimuli, and interactions with other cellular components .

What are the most promising future research directions for APOLD1?

Several key areas represent particularly promising avenues for advancing APOLD1 research:

Mechanistic Studies:

  • Detailed structural analysis of APOLD1 to understand its membrane interaction domains

  • Identification of APOLD1 binding partners and signaling pathways

  • Investigation of post-translational modifications that regulate APOLD1 function

Disease Associations:

  • Expanded genetic screening in patients with unexplained bleeding disorders or vascular abnormalities

  • Development of animal models harboring human APOLD1 mutations

  • Exploration of APOLD1 involvement in common vascular diseases (atherosclerosis, thrombosis)

Therapeutic Applications:

  • Small molecule modulators of APOLD1 function

  • APOLD1-targeted gene therapy approaches

  • Biomarkers based on APOLD1 levels or mutations for vascular disease risk assessment

Advancing these research directions will likely yield significant insights into both basic vascular biology and potential clinical applications related to APOLD1 function .

What standardized protocols should researchers adopt when working with APOLD1?

To enhance reproducibility and facilitate comparison between studies, researchers working with APOLD1 should consider adopting these standardized protocols:

For Recombinant Protein Studies:

  • Expression system: E. coli systems with N-terminal 10xHis tags

  • Purity assessment: >85% as determined by SDS-PAGE

  • Quality control: Verification of protein integrity by Western blot prior to use

For Cell-Based Assays:

  • Cell models: Primary human endothelial cells (HUVECs or HDMECs) within passages 2-6

  • Transfection protocols: Optimized siRNA or plasmid delivery methods with standardized controls

  • Functional readouts: Endothelial permeability assays, WPB secretion quantification, and junction integrity assessment

For Patient Studies:

  • Genetic screening: Comprehensive analysis including adjacent nucleotide variants that may act in cis

  • Phenotyping: Standardized bleeding assessment tools and vascular function tests

  • Biobanking: Collection and storage of patient samples following established guidelines

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.