Recombinant Human Aquaporin-10 (AQP10)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant AQP10 is produced in heterologous systems with high yields:

  • Yeast (P. pastoris):

    • Yield: 30 mg/L .

    • Glycosylation: Confirmed via PNGase F digestion and mass spectrometry .

  • HEK293 cells:

    • Purity: >90% (His-tagged) .

    • Tag options: Strep-tag or His-tag for affinity chromatography .

Production Systems Comparison

SystemYieldGlycosylationTag Options
P. pastoris30 mg/LN-linkedNone
HEK293CustomNot observedHis-tag, Strep-tag
E. coliLowerAbsentHis-tag (full-length)

Functional Characterization

Recombinant AQP10 demonstrates substrate specificity and pH-dependent activity:

  • Transport substrates:

    • Water (Pf=4.3×104cm/sP_f = 4.3 \times 10^{-4} \, \text{cm/s}) .

    • Glycerol, erythritol, xylitol .

  • pH modulation:

    • Glycerol permeability increases 2.5-fold at pH 6.0 vs. pH 7.4 .

    • MD simulations confirm His80 protonation triggers gate opening .

Functional Transport Profile

SubstratePermeability (Relative to Water)pH Sensitivity
Water1.0No
Glycerol0.8Yes (pH <6.5)
Erythritol0.6Moderate
UreaNot detectedN/A

Biochemical Properties

  • Thermostability:

    • Glycosylated AQP10: Tm=52CT_m = 52^\circ \text{C} .

    • Non-glycosylated: Tm=46CT_m = 46^\circ \text{C} .

  • Oligomeric state: Tetrameric in detergent solution .

  • Post-translational modifications:

    • N-glycosylation enhances stability by 3–6°C .

    • No O-glycosylation observed .

Research and Therapeutic Applications

  • Obesity research: AQP10-mediated glycerol efflux reduces adipocyte triglyceride accumulation .

  • Drug targeting: pH gate modulation could constitutively activate glycerol secretion for metabolic disorders .

  • Intestinal absorption studies: Apical localization in enterocytes suggests roles in dietary glycerol uptake .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your requirements for preferential development of a specific tag.
Synonyms
AQP10; Aquaporin-10; AQP-10; Aquaglyceroporin-10; Small intestine aquaporin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-301
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
AQP10
Target Protein Sequence
MVFTQAPAEIMGHLRIRSLLARQCLAEFLGVFVLMLLTQGAVAQAVTSGETKGNFFTMFLAGSLAVTIAIYVGGNVSGAHLNPAFSLAMCIVGRLPWVKLPIYILVQLLSAFCASGATYVLYHDALQNYTGGNLTVTGPKETASIFATYPAPYLSLNNGFLDQVLGTGMLIVGLLAILDRRNKGVPAGLEPVVVGMLILALGLSMGANCGIPLNPARDLGPRLFTYVAGWGPEVFSAGNGWWWVPVVAPLVGATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECKL
Uniprot No.

Target Background

Function
Aquaporin-10 (AQP10) is a water channel protein facilitating water transport across cell membranes regardless of cytosolic pH. It also exhibits permeability to glycerol, particularly under acidified cytosolic conditions. AQP10 contributes to adipocyte water and glycerol permeability, potentially influencing glycerol utilization from phospholipid degradation. It may also play a role in intestinal water transport.
Gene References Into Functions

Aquaporin-10 (AQP10) Research Highlights:

  1. CXCL4, AQP3, and AQP10 mRNA expression in middle ear effusion is linked to otitis media with effusion pathophysiology. PMID: 26810286
  2. Human aquaglyceroporins (AQP3, AQP7, AQP9, and AQP10) function as silicon transporters in Xenopus laevis oocytes and HEK-293 cells. PMID: 26313002
  3. Adipocyte-specific AQP10 expression is crucial for maintaining normal or low intracellular glycerol levels, potentially protecting against obesity. PMID: 23382902
  4. Glycosylation of at least one protomer in the AQP10 tetramer enhances the structural stability of the entire complex. PMID: 21733844
  5. AQP10 exhibits dual functionality as a solute carrier/channel, offering insights into its operational mechanism and physiological role. PMID: 21691092
  6. AQP10 is classified as a new member of aquaglyceroporins, both functionally and structurally. PMID: 12084581
  7. Two AQP10 isoforms, differing by a 475 nt insertion, show distinct localization in intestinal villi: one in capillary endothelium and the other in gastro-entero-pancreatic endocrine cells. PMID: 15898950
  8. Differential polarity and targeting of AQP3 and AQP10 in intestinal epithelial cells are influenced by amino acid signal motifs. PMID: 18678926
Database Links

HGNC: 16029

OMIM: 606578

KEGG: hsa:89872

STRING: 9606.ENSP00000318355

UniGene: Hs.259048

Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Apical cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Lipid droplet.
Tissue Specificity
Detected in epithelial cells on villi in the ileum, and also in stomach, jejunum, colon, rectum, white adipose tissue and placenta (at protein level). Expressed in duodenum and jejunum. Highest expression in absorptive epithelial cells at the tips of vill

Q&A

What is Recombinant Human Aquaporin-10 (AQP10)?

Recombinant Human Aquaporin-10 is a laboratory-produced form of the human membrane protein AQP10, which belongs to the aquaglyceroporin subfamily of aquaporins. While orthodox aquaporins primarily transport water, aquaglyceroporins like AQP10 can conduct both water and small uncharged solutes such as glycerol. AQP10 is one of four human aquaglyceroporins (along with AQP3, AQP7, and AQP9) that facilitate glycerol movement across cellular membranes . The recombinant form is typically expressed in heterologous systems such as yeast (S. cerevisiae) with modifications that can include truncations and/or fusion tags to aid in purification and functional studies. For crystallization studies, researchers have successfully used a truncated version (hAQP10ᶜʳʸˢᵗ) with the first 10 N-terminal and last 24 C-terminal amino acids removed .

What is the structural architecture of human AQP10?

Human AQP10 exhibits the canonical aquaporin fold with six transmembrane helices (TM1-TM6) and two half-helices that form a pseudo-hourglass structure. The crystal structure, determined at 2.3 Å resolution, reveals AQP10 as a homotetramer with each monomer forming an independent water/glycerol-conducting channel .

What distinguishes AQP10 from other aquaporins are two critical structural features:

  • An exceptionally wide aromatic/arginine (ar/R) selectivity filter (2.6 Å) at the non-cytoplasmic end of the pore, significantly broader than in other structurally characterized aquaporins .

  • A unique cytoplasmic gate formed by loop B (G73-H80), with V76-S77 capping the cytoplasmic opening, along with F85 and R94 stabilizing the loop in a closed configuration at neutral/high pH .

The NPA (asparagine-proline-alanine) motif, a hallmark of aquaporins, is present at positions N82-A84, where a glycerol molecule has been observed to bind in the crystal structure, indicating this region's role in substrate coordination during transport .

Where is AQP10 expressed in human tissues and what is its physiological significance?

AQP10 shows tissue-specific expression patterns with notable presence in:

  • Adipose tissue: Immunolabeling confirms plasma membrane localization in adipocytes, where AQP10 plays a crucial role in glycerol efflux during lipolysis .

  • Small intestine: AQP10 is expressed in duodenal enterocytes, where it contributes to glycerol absorption from the intestinal lumen, particularly important in states of fasting or during ketogenic diets .

The physiological significance of AQP10 is primarily linked to glycerol homeostasis. Glycerol released from adipose tissue serves as an important precursor for gluconeogenesis in the liver during fasting states. The uptake of dietary glycerol through intestinal AQP10 and release of glycerol from adipocytes during fat mobilization are key processes in maintaining whole-body energy balance . Research in mice has shown that disruption of aquaglyceroporin function (specifically AQP7 knockouts) leads to glycerol and triacylglycerol accumulation, enlarged adipocytes, and age-related obesity, suggesting similar critical roles for human AQP10 .

How is AQP10 activity regulated in adipocytes?

Unlike other aquaporins that are primarily regulated through trafficking (subcellular redistribution in response to hormones), AQP10 exhibits a unique pH-dependent regulation mechanism. In human adipocytes, AQP10 activity correlates with cytosolic pH changes:

  • During lipolysis (induced by catecholamines like isoproterenol): Internal acidification occurs, which stimulates glycerol release through AQP10 .

  • During lipogenesis (insulin-stimulated): No significant pH change is observed, and glycerol flux remains baseline .

Experimental evidence demonstrates that glycerol permeability (P₍ₗy) of AQP10 significantly increases at acidic pH (pH 5.5) compared to physiological pH (pH 7.4), while water permeability (P𝑓) remains unaffected by pH changes . This pH-dependent regulation appears to be specific to AQP10 among human aquaglyceroporins, as AQP3, AQP7, and AQP9 maintain glycerol permeability only at neutral pH .

What is the molecular basis for the pH-dependent gating mechanism of AQP10?

The pH-dependent gating of AQP10 is governed by a cytoplasmic gate that operates via a unique molecular mechanism:

  • pH sensor: Histidine 80 (H80) located in loop B acts as the critical pH-sensing residue. At neutral/high pH, H80 (monoprotonated state) stabilizes loop B in a closed configuration through interactions with F85 and R94 .

  • Gate opening: At low pH, H80 becomes doubly protonated, leading to a structural rearrangement where:

    • H80 reorients and becomes stabilized by E27

    • F85 adapts a more open side-chain orientation

    • Loop B (including V76-S77) rearranges in conjunction with R94

    • These changes create a wider pore (approximately 1.5 Å width) sufficient for glycerol permeation

Molecular dynamics simulations reveal that the pKa value of H80 increases from 3.6 in the closed state to 7.1 in the open state, explaining its sensitivity to physiologically relevant pH changes. The simulations also identified distinctive conformational clusters representing the transition from closed to open states upon H80 protonation .

How do structural features of AQP10 contribute to its unique pH sensitivity compared to other aquaglyceroporins?

AQP10's unique pH sensitivity stems from several distinctive structural features not present in other aquaglyceroporins:

  • Glycerol-specific cytoplasmic gate: Unlike other aquaporins, AQP10 has a cytoplasmic constriction (0.9 Å) that permits water but restricts glycerol passage at neutral pH. This gate includes:

    • A unique G73G74-motif in loop B that enables the specific loop architecture

    • The presence of F85 (instead of valine/isoleucine found in other AQPs) with a side-chain configuration unfavorable for glycerol passage at neutral pH

    • A distinctive arrangement of V76-S77 capping the cytoplasmic opening

  • Exceptionally wide ar/R filter: The non-cytoplasmic end of the pore has a significantly wider selectivity filter (2.6 Å) compared to other AQPs, suggesting that selectivity control has shifted from this traditional filter region to the cytoplasmic gate .

  • H80 positioning: The location and environment of H80 in AQP10 is optimized for pH sensing, with its protonation state directly influencing the configuration of surrounding residues that form the gate .

These structural adaptations create a pH-responsive glycerol channel that remains permeable to water regardless of pH while regulating glycerol flux in response to cellular acidification .

What expression systems are optimal for producing recombinant human AQP10?

For successful production of recombinant human AQP10, researchers have employed the following systems and strategies:

  • Yeast expression system:

    • Saccharomyces cerevisiae strain PAP1500 has been successfully used for high-yield production

    • Codon-optimized human AQP10 cDNA enhances expression

    • Expression constructs typically incorporate:

      • C-terminal purification tags (octa-histidine or deca-histidine)

      • Optional fusion partners (e.g., GFP) with TEV protease cleavage sites

      • Truncations to improve stability (e.g., removal of first 10 N-terminal and last 24 C-terminal amino acids for crystallization studies)

  • Plasmid assembly:

    • Homologous recombination directly in the production strain offers efficient construct generation

    • Methionine-repressible promoters (in vectors like pUG35) allow controlled expression

    • Variants can be generated through site-directed mutagenesis using PCR-based methods

The yeast system offers advantages for membrane protein production, including eukaryotic protein processing machinery and scalable cultivation. For functional studies, researchers can employ both full-length and engineered variants of AQP10 with appropriate tags for detection and purification .

What methods can be used to assess AQP10-mediated glycerol transport?

Several complementary approaches can be employed to measure AQP10-mediated glycerol transport:

  • Vesicle-based transport assays:

    • Human adipocyte membrane vesicles: Prepared from adipose tissue to assess native protein function

    • Biomimetic vesicles (polymersomes): Artificial vesicles with reconstituted purified AQP10

    • These systems can be subjected to osmotic gradients to measure:

      • Water permeability (P𝑓) through light scattering changes

      • Glycerol permeability (P₍ₗy) at varying pH conditions (typically pH 7.4 vs. pH 5.5)

  • Fluorescence-based monitoring:

    • GFP-tagged AQP10 allows confirmation of proper membrane localization

    • Fluorescence-based assays can monitor vesicle shrinkage/swelling in response to osmotic challenges

  • Cellular glycerol release measurements:

    • Direct measurement of glycerol release from adipocytes under different conditions:

      • Lipogenesis (insulin supplementation)

      • Lipolysis (isoproterenol supplementation)

    • These can be correlated with intracellular pH measurements to establish the relationship between acidification and glycerol flux

For comprehensive characterization, researchers should combine these approaches to analyze both the native protein in its cellular context and the purified protein in controlled reconstituted systems .

What crystallization strategies have proven successful for structural determination of AQP10?

The successful crystallization of human AQP10 involved several key strategies:

  • Protein engineering:

    • Truncation of termini (Δ1-10, Δ278-301) to remove potentially flexible regions

    • Maintaining the core structural elements required for function

  • Purification optimization:

    • Affinity chromatography using histidine tags

    • Use of appropriate detergents for membrane protein extraction and stabilization

  • Crystallization conditions:

    • Hanging-drop vapor diffusion at 18°C

    • Protein concentration: ~4 mg/mL

    • Additive: 0.3 mM n-nonyl-β-D-thioglucoside

    • Reservoir solution: 100 mM MES-monohydrate-NaOH pH 6.0, 19% PEG 2k MME, 5% glycerol

    • Flash freezing in liquid nitrogen for cryo-protection

  • Data collection and processing:

    • X-ray diffraction using an EIGER detector at a synchrotron source

    • Data processing with XDS software

    • Crystals belonged to space group P212121 with cell dimensions a = 97.1 Å, b = 116.8 Å, c = 138.5 Å

    • Molecular replacement using E. coli glycerol facilitator (GlpF) structure as a search model

This approach yielded a 2.3 Å resolution structure with an entire AQP10 tetramer in the asymmetric unit, allowing detailed analysis of the protein's architecture and the basis for its unique regulatory mechanisms .

How can molecular dynamics simulations enhance understanding of AQP10 function?

Molecular dynamics (MD) simulations provide powerful insights into AQP10 function, particularly for investigating dynamic processes not readily captured by static crystal structures:

  • Simulation setup for AQP10:

    • Embedding the tetrameric structure in a realistic membrane environment (e.g., POPE bilayer)

    • Creating systems with different protonation states of key residues (e.g., H80 monoprotonated vs. double protonated) to mimic pH conditions

    • Inclusion of explicit water molecules and physiological ion concentrations (150 mM Na+ and Cl-)

  • Analysis approaches:

    • Cluster and principal component analysis to identify core conformational groups

    • HOLE analysis to quantify pore dimensions in different states

    • Tracking of water and glycerol molecules to observe permeation events

    • Monitoring specific interactions between key residues during simulations

  • Insights gained:

    • Identification of conformational transitions between closed and open states

    • Quantification of pore widths required for glycerol passage (approximately 1.5 Å)

    • Observation of H80 reorientation upon protonation

    • Calculation of pKa shifts associated with conformational changes (H80 pKa shifts from 3.6 to 7.1)

    • Visualization of non-single file water arrangements in the ar/R region

MD simulations complemented the experimental structural and functional data by elucidating the dynamic opening mechanism of the AQP10 gate, confirming H80 as the critical pH sensor, and identifying the structural transitions required for glycerol permeation .

What is the role of AQP10 in adipocyte metabolism and glycerol homeostasis?

AQP10 plays a crucial role in adipocyte metabolism through its pH-regulated glycerol transport activity:

  • During lipolysis (fat burning):

    • Triacylglycerols (TAGs) are hydrolyzed into fatty acids and glycerol

    • This process induces intracellular acidification

    • Lower pH activates AQP10's glycerol-conducting capabilities

    • Enhanced glycerol efflux from adipocytes supplies plasma glycerol for gluconeogenesis and energy production in other tissues

  • Contribution to whole-body glycerol homeostasis:

    • Adipocyte-derived glycerol constitutes the majority of plasma glycerol alongside dietary supply

    • This glycerol serves as fuel for peripheral tissues during fasting states

    • AQP10 in duodenal enterocytes facilitates dietary glycerol uptake

    • The bidirectional transport capabilities of AQP10 in different tissues create a balanced glycerol circuit

  • Metabolic implications:

    • Studies in mice with aquaglyceroporin knockouts (specifically AQP7) have demonstrated:

      • Accumulation of glycerol and TAGs

      • Development of enlarged adipocytes

      • Age-related obesity

    • This suggests that proper aquaglyceroporin function, including AQP10, is essential for preventing excessive fat accumulation

The pH-responsive regulation of AQP10 represents a sophisticated mechanism linking the metabolic state of adipocytes (lipolysis) with the appropriate physiological response (glycerol release) .

How does AQP10 differ functionally from other human aquaglyceroporins?

Human aquaglyceroporins (AQP3, AQP7, AQP9, and AQP10) share the ability to transport both water and glycerol, but AQP10 exhibits several distinctive functional characteristics:

  • pH-dependent glycerol permeability:

    • AQP10: Glycerol permeability is significantly enhanced at low pH (pH 5.5) and reduced at physiological pH (pH 7.4)

    • AQP3, AQP7, AQP9: Glycerol permeability is maintained at physiological pH (pH 7.4) but diminished at low pH

  • Water permeability characteristics:

    • All aquaglyceroporins, including AQP10, maintain pH-insensitive water permeability

    • This allows AQP10 to continuously facilitate water movement while selectively regulating glycerol flux

  • Regulation mechanisms:

    • AQP10: Primarily regulated through pH-dependent gating at the cytoplasmic interface

    • Other aquaglyceroporins: Typically regulated through trafficking (e.g., catecholamine/insulin-dependent subcellular redistribution of AQP7 in adipocytes)

  • Tissue distribution and physiological roles:

    • AQP10: Prominently expressed in adipose tissue and small intestine, with specific roles in lipolysis-associated glycerol release and intestinal glycerol absorption

    • AQP3: Broadly expressed, including in kidney, skin, and digestive tract

    • AQP7: Primarily found in adipose tissue and kidney

    • AQP9: Mainly expressed in liver, enabling glycerol uptake for gluconeogenesis

These functional differences position AQP10 as a uniquely regulated conduit for glycerol, with its activity specifically linked to the metabolic state of adipocytes through pH sensing .

What are the potential therapeutic implications of targeting AQP10 for metabolic diseases?

The unique pH-dependent regulation of AQP10 and its role in glycerol homeostasis suggest several potential therapeutic approaches for addressing metabolic diseases:

  • Targeting the cytoplasmic gate to modify glycerol flux:

    • Compounds that stabilize AQP10 in the open configuration could enhance glycerol release from adipocytes

    • Increased glycerol efflux may prevent accumulation of triacylglycerols inside adipocytes

    • This approach could potentially reduce adipocyte hypertrophy and obesity

  • Structure-based drug design opportunities:

    • The resolved crystal structure of AQP10 provides a molecular template for designing:

      • Small molecules targeting the H80 pH-sensing mechanism

      • Compounds that could interact with key residues in the cytoplasmic gate (F85, R94)

      • Modulators that could affect loop B configuration

  • Potential therapeutic contexts:

    • Obesity: Enhancing glycerol release to reduce fat accumulation

    • Type 2 diabetes: Improving glycerol homeostasis to address metabolic dysregulation

    • Other metabolic complications: Addressing conditions where aberrant lipid storage contributes to pathophysiology

  • Consideration of tissue-specific effects:

    • Interventions would need to account for the different roles of AQP10 in adipose tissue versus intestinal absorption

    • Targeted delivery approaches might be necessary to achieve adipocyte-specific effects

The unique pH-responsive properties of AQP10 provide a potential mechanistic link that could be exploited therapeutically, although additional research is needed to fully validate this target and develop specific modulators .

What experimental approaches can be used to investigate specific amino acid residues in the pH-sensing mechanism of AQP10?

To investigate the specific roles of amino acid residues in AQP10's pH-sensing mechanism, researchers can employ several complementary approaches:

These approaches would provide comprehensive insights into the specific contributions of individual residues to the pH-sensing mechanism and could identify key interaction networks required for AQP10's unique regulation .

How can the differential regulation of AQP10 in adipocytes versus intestinal cells be investigated?

Investigating the tissue-specific regulation of AQP10 in adipocytes versus intestinal cells requires approaches that address the unique physiological contexts of these different tissues:

  • Comparative expression analysis:

    • Quantify AQP10 protein and mRNA levels in both tissues under various conditions

    • Characterize post-translational modifications that might differ between tissues

    • Identify tissue-specific binding partners through co-immunoprecipitation and mass spectrometry

    • Determine subcellular localization patterns using immunofluorescence microscopy

  • Tissue-specific pH regulation:

    • Measure intracellular pH in adipocytes and enterocytes under physiological and stimulated conditions

    • Correlate pH changes with AQP10 activity in each cell type

    • Determine if intestinal cells exhibit similar pH-dependent regulation during relevant physiological processes

  • Ex vivo and in vitro studies:

    • Develop primary culture models of human adipocytes and intestinal cells

    • Create tissue-specific organoids to better recapitulate the physiological environment

    • Apply tissue-relevant stimuli (e.g., fasting/feeding for intestinal cells, lipolytic agents for adipocytes)

    • Measure glycerol transport in response to these stimuli

  • In vivo approaches:

    • Develop tissue-specific knockout or knockdown models

    • Use stable isotope-labeled glycerol to trace flux through different tissues

    • Implement tissue-specific expression of pH-insensitive AQP10 mutants

    • Monitor metabolic parameters in these models

  • System biology approaches:

    • Perform transcriptomic and proteomic analyses of both tissues

    • Identify tissue-specific regulatory networks affecting AQP10 function

    • Model the integration of AQP10 function within tissue-specific metabolic pathways

What are the emerging techniques for studying AQP10 dynamics at the molecular level?

Advanced techniques for studying AQP10 dynamics at the molecular level include:

  • Advanced structural approaches:

    • Time-resolved crystallography to capture intermediate states during pH-induced conformational changes

    • Single-particle cryo-electron microscopy with different pH conditions to visualize conformational ensembles

    • Solid-state NMR of membrane-embedded AQP10 to detect subtle structural changes upon pH alteration

  • Single-molecule techniques:

    • Single-molecule FRET to monitor distance changes between strategic positions during gating

    • Atomic force microscopy to measure mechanical properties of AQP10 in different conformational states

    • Single-channel recordings using specialized lipid bilayer systems to detect individual glycerol passage events

  • Advanced computational methods:

    • Enhanced sampling molecular dynamics to access longer timescales of conformational changes

    • Markov state modeling to map the conformational landscape of AQP10

    • Quantum mechanics/molecular mechanics calculations to accurately model protonation events

    • Machine learning approaches to identify cryptic binding sites for potential modulators

  • Biophysical characterization:

    • Stopped-flow spectroscopy with pH jumps to measure real-time conformational changes

    • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions and solvent exposure

    • Vibrational spectroscopy methods (e.g., FTIR, Raman) to detect changes in protonation states

  • Functional dynamics approaches:

    • Development of fluorescent glycerol analogs to directly visualize transport events

    • Optogenetic tools to rapidly induce pH changes in specific cellular compartments

    • Nanoscale imaging of AQP10 clustering and distribution in plasma membranes

These cutting-edge approaches would provide unprecedented insights into the molecular dynamics of AQP10, particularly the rapid conformational changes associated with pH sensing and gate opening that are challenging to capture with traditional techniques .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.