Recombinant Human Aquaporin-3 (AQP3)

Shipped with Ice Packs
In Stock

Description

Definition and Production

Recombinant Human Aquaporin-3 (AQP3) is synthesized using heterologous expression systems such as Escherichia coli or mammalian cell lines (e.g., HEK293T). This protein retains the native ability to transport water, glycerol, urea, and hydrogen peroxide (H2_2O2_2) across cell membranes .

Key Production Methods:

SystemDescriptionYieldTag
E. coli CFCell-free synthesis with Brij-98 detergent; functional reconstitution in liposomes Milligram scale6xHis tag
HEK293TTransient transfection; high-fidelity post-translational modifications >50 µg/mLC-Myc/DDK tag

Functional Properties

AQP3 facilitates bidirectional transport of multiple solutes, validated through assays like stopped-flow light scattering and gene-editing studies .

Functional Assays:

SolutePermeabilityInhibitorsAssay
WaterHighHgCl2_2 Osmotic swelling
GlycerolModeratePhloretin Radiolabeled uptake
H2_2O2_2ConfirmedN/AFluorescence

Knockout models (e.g., AQP3/^{-/-} mice) show impaired epidermal hydration, wound healing, and tumor resistance .

4.1. Cell Migration and Cancer

  • Mechanism: AQP3 overexpression enhances migration/invasion in trophoblasts (via PDGF-B/PI3K-AKT pathways) and cancer cells (via ERK1/2 and NF-κB) .

  • Cancer Link: Correlates with poor prognosis in breast, gastric, and colorectal cancers .

4.2. Skin Biology

  • Hydration: AQP3/^{-/-} mice exhibit reduced stratum corneum elasticity .

  • Disease Role: Elevated in atopic eczema but reduced in psoriasis .

4.3. Gastrointestinal Health

  • Diarrhea/Constipation: Modulates water transport; downregulated during viral enteritis (e.g., PEDV) .

  • Oxidative Stress: Mediates H2_2O2_2 transport, influencing intestinal barrier function .

Clinical and Therapeutic Relevance

ConditionAQP3 RoleTherapeutic Target
Nephrogenic DiabetesImpaired urine concentration due to basolateral membrane dysfunction AQP3/AQP4 dual KO
RosaceaPromotes inflammation via NF-κB activation in keratinocytes Topical inhibitors
Cancer MetastasisEnhances cell proliferation and epithelial-mesenchymal transition siRNA/shRNA

Challenges and Future Directions

  • Structural Studies: Limited high-resolution data due to expression hurdles .

  • Therapeutic Development: Need for isoform-specific inhibitors to avoid off-target effects .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order, and we will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
AQP3; Aquaporin-3; AQP-3; Aquaglyceroporin-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-292
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
AQP3
Target Protein Sequence
MGRQKELVSRCGEMLHIRYRLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTIN LAFGFAVTLGILIAGQVSGAHLNPAVTFAMCFLAREPWIKLPIYTLAQTLGAFLGAGIVF GLYYDAIWHFADNQLFVSGPNGTAGIFATYPSGHLDMINGFFDQFIGTASLIVCVLAIVD PYNNPVPRGLEAFTVGLVVLVIGTSMGFNSGYAVNPARDFGPRLFTALAGWGSAVFTTGQ HWWWVPIVSPLLGSIAGVFVYQLMIGCHLEQPPPSNEEENVKLAHVKHKEQI
Uniprot No.

Target Background

Function
Aquaporin-3 (AQP3) is a water channel protein crucial for promoting glycerol permeability and water transport across cell membranes. It acts as a glycerol transporter in the skin and plays a vital role in regulating the stratum corneum and epidermal glycerol content. AQP3 is involved in skin hydration, wound healing, and tumorigenesis. In the kidneys, AQP3 provides the medullary collecting duct with high water permeability, allowing water movement along osmotic gradients. It exhibits slight permeability to urea and may function as a water and urea exit mechanism during antidiuresis in collecting duct cells. AQP3 may also play a significant role in gastrointestinal tract water transport and glycerol metabolism.
Gene References Into Functions
  1. Current research indicates that AQP3 and AQP5 expression may serve as a marker to differentiate between patients with dry mouth and those with Sjogren's syndrome. PMID: 29925705
  2. AQP3 expression was significantly upregulated, and miR-488 was significantly upregulated in osteosarcoma (OS) tissues and cell lines. MiR488 inhibited OS cell proliferation, invasion, and epithelial-mesenchymal transition (EMT) by directly downregulating AQP3 expression. The suppression of OS cell proliferation, invasion, and EMT was attributed to miR488 targeting AQP3. PMID: 30015825
  3. TFF peptides, rapidly produced at injury sites, increase AQP levels, particularly AQP3, enhancing the cells' ability to rapidly change shape as part of the restitutive process. TFF peptides also require functional AQP3 channels to induce cell migration. PMID: 29046361
  4. Altered expression of placental AQP3 may contribute to placental complications such as preeclampsia. PMID: 29567477
  5. Data suggest that AQP3 primarily localizes in the cytoplasm and can be targeted to the plasma membrane in prostate cancer cells via a cAMP/PKA/RalA pathway. PMID: 29532894
  6. Placental AQP3 expression is reduced in pre-eclampsia. PMID: 29108637
  7. In response to injury, AQP3-depleted colonic epithelial cells exhibited impaired lamellipodia formation, focal adhesions, and repair after wounding, along with reduced H2O2 responses following exposure to the intestinal pathogen Citrobacter rodentium. PMID: 28049834
  8. AQP3 siRNA and PLD2 siRNA significantly downregulated AQP3 and PLD2 mRNA and protein levels in A431 cells, inhibiting proliferation and promoting apoptosis in vitro. PMID: 28656282
  9. Reduced epidermal AQP-3 expression may contribute to impaired melanocyte survival in vitiligo, potentially serving as a negative biological marker for vitiligo activity. PMID: 26923934
  10. Research provides evidence for the involvement of the JNK pathway in AQP3 regulation in isolated oligohydramnios tissues in vitro, in amniotic epithelial cells derived from normal amniotic fluid and fluid from patients with isolated oligohydramnios. PMID: 27814615
  11. Results suggest that AQP3 promotes stem-like properties of gastric carcinoma (GC) cells by activating the Wnt/GSK-3beta/beta-catenin signaling pathway. PMID: 26918728
  12. Adiponectin increases AQP3 expression through PPARalpha-mediated signaling in hepatic stellate cells. PMID: 28595905
  13. Skin dryness observed in intrinsic and extrinsic aged skin may be partially explained by AQP3 downregulation. This finding could pave the way for new avenues to control skin texture and beauty. Future research can explore AQP3's interaction in skin protein organization and gene polymorphism. PMID: 26509906
  14. Epigenetic signatures at AQP3 and SOCS3 are involved in low-grade inflammation across different tissues, possibly via JAK/STAT-mediated pathways. PMID: 27824951
  15. RNA interference (RNAi) of aquaporin 3 (AQP3) retarded the growth and invasiveness of XWLC-05 lung cancer cells and decreased the activity of matrix metalloproteinase 2 (MMP2). PMID: 28189680
  16. Findings suggest that AQP3 promotes tumor growth in pancreatic cancer cells by activating the mTOR signaling pathway, providing a potential therapeutic target for the treatment of pancreatic ductal adenocarcinoma (PDAC). PMID: 28377226
  17. AQP3 was upregulated, and AQP7 and AQP9 were downregulated in hepatocellular carcinoma. High AQP3 expression and low AQP7 expression were significantly associated with aggressive features of hepatocellular carcinoma. PMID: 27121567
  18. AQP3 inhibition, inducing glycerol uptake reduction, and glycerol administration could potentially rehabilitate cell proliferation. PMID: 26768614
  19. AQP3 levels are increased in hepatocellular carcinoma. Auphen reduces AQP3 levels, suppressing tumor growth. PMID: 27022216
  20. AQP-3 plays roles in the complex of AQP-3 aquaglyceroporin and ClC-3 chloride channels. PMID: 26794461
  21. Treatment of human HepG2 cells with TCDD also increased AQP3 mRNA and protein expression. PMID: 26454884
  22. AQP3 knockdown retards the growth of non-small cell lung cancer (NSCLC) cells, partially through inhibiting HIF-1alpha/VEGF and Raf/MEK/ERK signaling pathways. PMID: 26765123
  23. AQP3 was found to be expressed in 67.71% of parts with gastric intestinal metaplasia (GIM), and AQP3 immunoreactivity was identified more frequently in severe GIM areas (P < 0.001). The incidence and severity of GIM correlated with the distance from gastric cancer (GC), and AQP3 was differentially expressed in goblet cells, with most AQP3-positive goblet cells presenting in severe GIM. PMID: 26506416
  24. AQP3 was expressed in trophoblast explants. Blocking it with CuSO4 prevented apoptosis. PMID: 26568619
  25. Expression of CXCL4 and aquaporin 3 and 10 mRNAs in middle ear effusion is associated with the pathophysiology of otitis media with effusion. PMID: 26810286
  26. Research demonstrates that AQP3 is required for CXCL12-induced breast cancer cell signaling and directional migration via a mechanism involving the CXCL12-induced generation of extracellular H2O2 and subsequent intracellular transport by AQP3. PMID: 26830227
  27. For the first time, an estrogen response element (ERE) was identified in the AQP3 gene promoter. Estrogen might promote breast cancer development by activating ERE in the AQP3 gene promoter and upregulating AQP3 expression in estrogen receptor (ER)-positive breast cancer. PMID: 26219409
  28. Findings suggest that AQP3 is required for EGF-EGFR cell signaling in cancer cells and is a therapeutic target for cancer progression. PMID: 26896765
  29. AQP3 may play a role in nonmelanoma skin cancer pathogenesis. PMID: 26107428
  30. Human aquaglyceroporins, including AQP3, AQP7, AQP9, and AQP10, can act as silicon transporters in both Xenopus laevis oocytes and HEK-293 cells. PMID: 26313002
  31. AQP3-facilitated H2O2 transport is required for NF-kappaB activation in keratinocytes during the development of psoriasis. PMID: 26100668
  32. AQP3 protein expression is regulated by the cAMP-PKA-CREB signaling pathway. PMID: 25961543
  33. Results suggest that morphine increases AQP3 expression levels in the colon, promoting water absorption from the luminal side to the vascular side and potentially causing constipation. PMID: 25766885
  34. Research reports down-regulation of aquaporin 3 expression by lipopolysaccharide via the p38/c-Jun N-terminal kinase signaling pathway in HT-29 human colon epithelial cells. PMID: 25914463
  35. AQP-3 expression is increased in burn wounds following injury. PMID: 25603981
  36. Oleic acid-induced hepatic steatosis in HepG2 cells is associated with the coordinated regulation of aquaporin 3 and aquaporin 9 via activation of p38 signaling. PMID: 25105540
  37. A correlation exists between AQP3 protein expression and tumor stage and grade in urothelial cancer, with AQP3 expression being reduced or lost in higher-grade and stage tumors. PMID: 24022233
  38. AQP3 induces ERK1/2 activation, increasing MMP3 expression and secretion, which in turn promotes prostate cancer cell motility and invasion. PMID: 25515250
  39. The opening of ClC-3 transports Cl(-) across the cell membrane, driving the efflux of water through AQP-3 channels and ion channels. AQP-3 may interact with ClC-3 to regulate chloride and water effluxes. PMID: 25450461
  40. AQP3 expression in tumor tissue may be considered a potential prognostic marker in patients with HER2-over-expressing estrogen receptor-positive breast cancer (EBC) after curative surgery. PMID: 25964557
  41. Research provides a mechanism by which AQP3 is upregulated, highlighting the importance of miR-874 in gastric cancer development and progression. PMID: 23800944
  42. Resveratrol inhibited NHEK proliferation by downregulating AQP3 expression in an SIRT1/ARNT/ERK-dependent manner. PMID: 24726500
  43. Research investigated AQP3 expression in the skin of an experimental burn model. Observations suggest that dermal AQP3 gene expression was increased to maintain water homeostasis in response to dehydration from burns. PMID: 24508472
  44. Research concludes that water fluxes accompanying cystic fibrosis transmembrane conductance regulator (CFTR) activity are linked to AQP3 but not to a cAMP-stimulated aqueous pore in the CFTR protein. PMID: 24338365
  45. AQP3 promotes epithelial-mesenchymal transition in human cases of gastric adenocarcinoma. PMID: 24887009
  46. Research analyzed the molecular link between the circadian clock and AQP3 function in mouse dorsal skin and HaCaT cells. PMID: 24418925
  47. The AQP3-Notch1 axis may provide insights into epidermal homeostasis control. PMID: 24260356
  48. Findings suggest, for the first time, that the aberrant expression of AQP3 and AQP5 proteins may be strongly related to tumor progression and prognosis in patients with hepatocellular carcinoma. PMID: 24224160
  49. AQP3-EGFP diffusion is altered upon increased cAMP, which may correspond to basolateral adaptations in response to increased apical water readsorption. PMID: 24452376
  50. High expression of both AQP3 and AQP5, not each alone, is an independent poor prognostic factor in esophageal squamous cell carcinoma (ESCC) patients. PMID: 23797770

Show More

Hide All

Database Links

HGNC: 636

OMIM: 600170

KEGG: hsa:360

STRING: 9606.ENSP00000297991

UniGene: Hs.234642

Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed in epithelial cells of kidney (collecting ducts) and airways, in keratinocytes, immature dendritic cells and erythrocytes. Isoform 2 is not detectable in erythrocytes at the protein level.

Q&A

What is the basic structure and function of human Aquaporin-3?

Human Aquaporin-3 is a membrane channel protein belonging to the aquaglyceroporin subfamily that facilitates the transport of water, glycerol, and some small neutral solutes across cell membranes . The protein has a molecular weight of approximately 31.4 kDa and consists of multiple transmembrane domains that form a central pore for selective transport . AQP3 is expressed primarily in the basolateral membranes of collecting duct cells in the kidney, as well as in the skin, gastrointestinal tract, and other tissues .

Unlike classical aquaporins that exclusively transport water, AQP3 has dual functionality as both a water and glycerol channel, which makes it particularly important in processes requiring osmotic balance and lipid metabolism . The protein features several functional domains that contribute to its selectivity and transport mechanisms, including a central pore lined with hydrophilic residues that facilitate water passage and regions that allow glycerol transport .

What expression systems are most effective for producing recombinant human AQP3?

Two primary expression systems have demonstrated effectiveness for producing recombinant human AQP3:

HEK293T Mammalian Expression System:
This system yields properly folded human AQP3 with appropriate post-translational modifications, making it suitable for studies requiring native-like protein characteristics . The HEK293T system typically produces moderate protein yields but with high biological activity and proper membrane integration .

Cell-Free (CF) Expression System:
For higher yield requirements, an Escherichia coli extract-based cell-free system has been developed that can produce milligram quantities of functional AQP3 . This system utilizes the non-ionic detergent Brij-98 during protein synthesis to maintain proper protein folding and functionality . The CF approach offers significant advantages in terms of speed, scalability, and the ability to produce membrane proteins that might be toxic when expressed in living cells .

Expression SystemAdvantagesDisadvantagesTypical YieldApplications
HEK293TNative-like PTMs, Proper foldingModerate yield, Higher costMicrogram rangeStructural studies, Functional assays
Cell-Free (E. coli extract)High yield, Rapid production, ScalableMay lack some PTMsMilligram rangeLarge-scale purification, Reconstitution experiments

What purification methods yield the highest purity recombinant AQP3?

Achieving high-purity recombinant AQP3 typically involves a multi-step purification process:

Affinity Chromatography:
The initial purification step often utilizes affinity tags such as histidine (His) or DDK (FLAG) tags that are engineered into the recombinant protein . For His-tagged AQP3 (hAQP3-6His), immobilized metal affinity chromatography (IMAC) using Ni-NTA resin is highly effective . Similarly, anti-DDK affinity columns can be used for DDK-tagged versions of the protein .

Conventional Chromatography:
Following affinity purification, additional chromatography steps are recommended to achieve higher purity levels . These may include:

  • Size exclusion chromatography (SEC) to separate monomeric AQP3 from aggregates and other contaminants

  • Ion exchange chromatography to remove impurities based on charge differences

  • Hydrophobic interaction chromatography for further refinement

The combination of affinity capture followed by conventional chromatography steps can yield AQP3 preparations with greater than 80% purity as determined by SDS-PAGE and Coomassie blue staining . For functional studies, it's essential to maintain the protein in an appropriate detergent environment throughout the purification process to preserve its native conformation and activity .

What are the optimal storage conditions for preserving AQP3 stability and functionality?

Maintaining the stability and functionality of purified recombinant AQP3 requires specific storage conditions:

Temperature:
Store purified AQP3 at -80°C for long-term preservation . This ultra-low temperature minimizes protein degradation and maintains structural integrity. For short-term storage (less than one week), -20°C may be sufficient if the protein is in an appropriate buffer with stabilizing agents.

Buffer Composition:
The recommended storage buffer typically contains:

  • 25 mM Tris-HCl as the primary buffer component

  • 100 mM glycine to maintain protein solubility

  • pH 7.3 to mimic physiological conditions

  • 10% glycerol as a cryoprotectant to prevent freeze-damage

Handling Recommendations:

  • Avoid repeated freeze-thaw cycles as they significantly reduce protein stability and activity

  • Consider aliquoting the purified protein into single-use volumes before freezing

  • When thawing, do so rapidly at room temperature or in a water bath at 25°C

  • For cell culture applications, filter the protein solution before use to ensure sterility

What functional assays can verify the activity of recombinant AQP3?

Several complementary approaches can validate the functional activity of recombinant AQP3:

Proteoliposome-Based Water and Glycerol Transport Assays:
The gold standard for functional characterization involves reconstituting purified AQP3 into liposomes and measuring transport activities using stopped-flow light scattering techniques . This approach allows quantitative assessment of both water and glycerol permeability by monitoring the rate of liposome shrinkage or swelling in response to osmotic gradients . The significantly higher permeability of AQP3-containing proteoliposomes compared to empty control liposomes provides direct evidence of proper protein folding and functionality .

Inhibition Studies:
Confirming the sensitivity of reconstituted AQP3 to known inhibitors provides further validation of proper functional conformation. Two established inhibitors can be used:

  • Phloretin: Strongly inhibits glycerol permeability through AQP3

  • HgCl₂ (mercuric chloride): Blocks water transport through interaction with cysteine residues in the AQP3 channel

A properly folded, functional AQP3 will show significant reduction in transport activities when exposed to these inhibitors at appropriate concentrations .

Cell-Based Functional Assays:
For AQP3 expressed in mammalian cell systems, functionality can be assessed through:

  • Cell volume regulation studies using hypotonic or hypertonic challenges

  • Glycerol uptake assays using radiolabeled glycerol

  • Fluorescence-based transport assays using volume-sensitive dyes

These complementary approaches provide robust validation of recombinant AQP3 functionality across different experimental contexts.

How can recombinant AQP3 be effectively incorporated into artificial membrane systems?

Incorporating recombinant AQP3 into artificial membrane systems requires careful consideration of lipid composition, protein-to-lipid ratios, and reconstitution protocols:

Liposome Reconstitution:
The most common approach involves reconstituting purified AQP3 into preformed liposomes through a detergent-mediated process . A typical protocol includes:

  • Preparation of unilamellar liposomes from a defined lipid mixture (often phosphatidylcholine and phosphatidylserine)

  • Solubilization of liposomes with a mild detergent (e.g., n-octyl-β-D-glucopyranoside or Triton X-100)

  • Addition of purified AQP3 at a protein-to-lipid ratio of 1:50 to 1:200 (w/w)

  • Controlled detergent removal using bio-beads, dialysis, or gel filtration

  • Quality control by dynamic light scattering to assess proteoliposome size distribution

Planar Lipid Bilayer Systems:
For electrophysiological studies, AQP3 can be incorporated into planar lipid bilayers by:

  • Forming stable lipid bilayers across apertures in supporting materials

  • Adding detergent-solubilized AQP3 directly to the chamber

  • Facilitating insertion through osmotic or electrical gradients

Polymeric Membrane Incorporation:
For biomimetic applications, AQP3 can be integrated into block copolymer membranes that offer greater mechanical stability than lipid systems. The incorporation typically involves:

  • Preparation of polymer vesicles (polymersomes)

  • Addition of purified AQP3 in appropriate detergent

  • Detergent removal through dialysis or biobeads

  • Confirmation of incorporation through freeze-fracture electron microscopy or functional assays

Successful reconstitution can be verified by measuring the enhanced water and glycerol permeability of the resulting proteoliposomes compared to protein-free controls using stopped-flow spectroscopy .

What structural modifications can enhance AQP3 stability without compromising function?

Several targeted modifications can enhance the stability of recombinant AQP3 while preserving its transport functionality:

Terminal Tag Optimization:
While tags are essential for purification, their positioning and composition can significantly impact stability:

  • C-terminal tags (such as C-Myc/DDK) generally cause less disruption to AQP3 folding and function than N-terminal modifications

  • Smaller tags (His₆) typically interfere less with protein structure than larger fusion partners

  • Incorporating flexible linker sequences between the AQP3 protein and tags can reduce steric hindrance and improve stability

Cysteine Modifications:
Strategic modification of surface-exposed cysteine residues can enhance stability:

  • Converting reactive cysteines to serines can prevent inappropriate disulfide formation during expression and purification

  • Retaining critical cysteines involved in mercury sensitivity is important for maintaining characteristic inhibition profiles

Terminal Truncations:
Selective removal of disordered terminal regions can improve expression and stability:

  • Trimming flexible N- or C-terminal sequences that are not essential for channel formation or regulation

  • Preserving regions involved in oligomerization and trafficking

Buffer Optimization:
Beyond standard storage conditions, specialized buffer additives can further enhance stability:

  • Addition of glycerol (10-20%) as both a stabilizer and potential substrate

  • Inclusion of specific lipids that associate with AQP3 in its native environment

  • Selected amino acids (arginine, glutamate) that can prevent aggregation through weak interactions with protein surfaces

These modifications should be evaluated through comparative functional assays to ensure that stability enhancements do not compromise the essential transport properties of AQP3 .

How does recombinant AQP3 compare functionally to native AQP3 in transport assays?

Comparative functional analysis between recombinant and native AQP3 reveals important similarities and differences that researchers should consider:

Water Permeability:
Properly folded recombinant AQP3 demonstrates water transport capabilities comparable to native AQP3 when reconstituted into proteoliposomes . Both exhibit:

  • High osmotic water permeability coefficients (Pf values)

  • Similar temperature dependence (activation energy)

  • Characteristic inhibition profiles with mercury compounds

Glycerol Transport:
Recombinant AQP3 maintains the distinctive glycerol transport function of native AQP3, with some system-dependent variations:

  • HEK293T-expressed AQP3 typically shows glycerol permeability very close to native levels

  • Cell-free produced AQP3 may exhibit slightly different kinetics depending on reconstitution conditions

  • Both recombinant forms demonstrate the expected inhibition by phloretin

Oligomeric State:
Native AQP3 functions as a tetramer, and recombinant preparations should maintain this quaternary structure:

  • Properly prepared recombinant AQP3 forms tetramers similar to native protein

  • Size exclusion chromatography and native PAGE can confirm the correct oligomeric state

  • Functional differences sometimes observed in recombinant preparations may relate to incomplete tetramerization

Post-translational Modifications:
The expression system significantly impacts post-translational modifications:

  • HEK293T-expressed AQP3 contains mammalian-type glycosylation and phosphorylation patterns similar to native protein

  • Cell-free or bacterial expression systems lack these modifications, potentially affecting regulatory properties but generally preserving basic transport functions

What are common pitfalls in functional reconstitution of AQP3, and how can they be addressed?

Reconstitution of AQP3 into artificial membrane systems presents several challenges that can impact experimental outcomes:

Inadequate Detergent Removal:
Residual detergent can create artifacts in permeability measurements by causing leaky proteoliposomes or destabilizing the protein.

Solutions:

  • Extend bio-bead incubation times or use multiple sequential additions of fresh beads

  • Implement dialysis against detergent-free buffer with multiple buffer exchanges

  • Apply size exclusion chromatography as a final polishing step to remove detergent micelles

  • Quantify residual detergent using colorimetric assays to confirm complete removal

Improper Protein Orientation:
Random insertion of AQP3 into liposomes results in mixed orientations, complicating data interpretation.

Solutions:

  • Use asymmetric reconstitution protocols that favor unidirectional insertion

  • Apply protease digestion to selectively remove externally oriented protein domains

  • Develop orientation-specific antibody labeling to quantify the proportion of correctly oriented channels

  • Account for bidirectional insertion mathematically when analyzing permeability data

Protein Aggregation During Reconstitution:
AQP3 can aggregate during the transition from detergent micelles to lipid bilayers.

Solutions:

  • Maintain the protein in suitable detergent (e.g., Brij-98) throughout the process

  • Include glycerol (5-10%) in reconstitution buffers to stabilize the protein

  • Perform reconstitution at reduced temperatures (4-15°C) to minimize aggregation

  • Filter solutions immediately before reconstitution to remove pre-formed aggregates

Suboptimal Lipid Composition:
The lipid environment significantly impacts AQP3 stability and function.

Solutions:

  • Include cholesterol (10-20 mol%) to enhance membrane organization and protein stability

  • Use a mixture of phospholipids that mimics the native membrane environment

  • Avoid highly charged lipids that may interfere with AQP3 folding or function

  • Systematically test different lipid compositions to identify optimal reconstitution conditions

Addressing these challenges through careful optimization of reconstitution protocols will significantly improve the reliability and reproducibility of functional AQP3 studies .

How can researchers differentiate between water and glycerol transport in AQP3 functional assays?

Distinguishing between water and glycerol transport through AQP3 requires specialized experimental approaches:

Selective Substrate Gradients:
Creating specific osmotic or solute gradients allows selective measurement of different transport activities:

  • Water-Specific Transport:

    • Generate purely osmotic gradients using membrane-impermeant solutes (e.g., sucrose, dextran)

    • Measure rapid initial rate of volume change using stopped-flow light scattering

    • Calculate osmotic water permeability coefficient (Pf) from the exponential rate constant

  • Glycerol-Specific Transport:

    • Create an isotonic glycerol gradient where water movement is minimized

    • Monitor the biphasic response: initial water efflux followed by glycerol and water influx

    • Calculate glycerol permeability coefficient (Pgly) from the second phase rate constant

Differential Inhibition Patterns:
Exploit the differential sensitivity of water and glycerol transport to specific inhibitors:

InhibitorWater Transport InhibitionGlycerol Transport InhibitionWorking Concentration
PhloretinModerateStrong0.5-1.0 mM
HgCl₂StrongModerate0.3-1.0 mM
CuSO₄ModerateWeak1.0-5.0 mM
TEAWeakModerate1.0-10.0 mM

By applying these inhibitors selectively, researchers can parse out the relative contributions of each transport pathway .

Temperature Dependence Analysis:
Water and glycerol transport through AQP3 exhibit different activation energies (Ea):

  • Water transport: Typically lower Ea (3-6 kcal/mol)

  • Glycerol transport: Higher Ea (10-15 kcal/mol)

Measuring transport rates at multiple temperatures (typically 10°C, 20°C, and 30°C) and constructing Arrhenius plots allows calculation of activation energies, providing another means to differentiate between transport mechanisms.

Direct Substrate Tracking:
For definitive differentiation:

  • Use isotopically labeled glycerol (³H-glycerol) to directly track glycerol movement

  • Combine with water transport measurements using D₂O or fluorescent volume indicators

  • This approach provides unambiguous distinction between the two transport pathways

These complementary approaches enable comprehensive characterization of the dual functionality of recombinant AQP3 .

What quality control methods ensure proper folding and functionality of recombinant AQP3?

Ensuring the proper folding and functionality of recombinant AQP3 requires a multi-faceted quality control approach:

Biochemical Assessment:

  • SDS-PAGE Analysis: Evaluate protein purity and apparent molecular weight (31.4 kDa for monomeric AQP3)

  • Native PAGE: Confirm correct oligomeric state (tetramer formation)

  • Western Blotting: Verify identity using specific anti-AQP3 antibodies or tag-specific antibodies

  • Circular Dichroism (CD): Assess secondary structure content, particularly alpha-helical content characteristic of properly folded aquaporins

Structural Integrity:

  • Size Exclusion Chromatography (SEC): Monitor homogeneity and detect aggregation or degradation

  • Thermal Shift Assays: Measure protein stability through melting temperature (Tm) determination

  • Limited Proteolysis: Properly folded AQP3 shows characteristic resistance to proteolytic cleavage

  • Fluorescence Spectroscopy: Intrinsic tryptophan fluorescence can indicate proper tertiary structure

Functional Validation:

  • Proteoliposome Water Permeability: Confirm significantly higher water transport rates compared to control liposomes

  • Glycerol Transport Assays: Verify characteristic glycerol permeability

  • Inhibitor Sensitivity: Test responsiveness to known AQP3 inhibitors (phloretin for glycerol transport, HgCl₂ for water transport)

  • pH Sensitivity Profile: Assess functional activity across a range of pH values (5.0-9.0)

Advanced Structural Analysis:

  • Negative Stain Electron Microscopy: Visualize protein particles to confirm appropriate size and shape

  • Cryo-EM Analysis: For higher-resolution structural confirmation when sufficient quantities are available

  • Mass Spectrometry: Verify intact mass and detect potential post-translational modifications

A comprehensive quality control workflow incorporating multiple orthogonal methods provides confidence in the structural and functional integrity of recombinant AQP3 preparations for downstream experimental applications .

How can researchers optimize cell-free expression systems for higher yields of functional AQP3?

Maximizing yield and functionality of cell-free expressed AQP3 requires strategic optimization of multiple parameters:

Reaction Component Optimization:

  • Extract Preparation: Enhance extract preparation by including additional chaperones or modifying cell growth conditions before extract preparation

  • DNA Template Design: Optimize codon usage for cell-free expression and include appropriate regulatory elements

  • Reaction Buffer Composition: Adjust magnesium and potassium concentrations, which critically influence translation efficiency

  • Energy Regeneration System: Implement enhanced ATP regeneration systems to extend reaction duration

Membrane Protein-Specific Adaptations:

  • Detergent Selection: While Brij-98 has proven effective for AQP3, systematic screening of detergent type and concentration can further improve yields

  • Lipid Supplementation: Addition of specific lipids (phosphatidylcholine, cholesterol) during synthesis can enhance co-translational folding

  • Molecular Chaperones: Supplement reactions with chaperones (DnaK/DnaJ/GrpE, GroEL/GroES) to improve folding efficiency

  • Disulfide Bond Formation: For proteins requiring disulfide bonds, include oxidized/reduced glutathione pairs

Reaction Format Optimization:

  • Continuous Exchange Cell-Free (CECF) System: Implement dialysis-based formats that remove inhibitory byproducts and replenish substrates

  • Temperature Cycling: Apply temperature cycles between optimal translation (30°C) and folding (15-20°C) temperatures

  • Reaction Scale: Optimize volumes from micro-scale screening to preparative production scales

  • Reaction Duration: Extend productive synthesis through feeding strategies or continuous exchange

Post-Translational Processing:

  • Purification Strategy Integration: Design cell-free reactions compatible with downstream purification by including appropriate detergents

  • One-Step Procedures: Develop approaches that combine synthesis and incorporation into nanodiscs or liposomes

  • Quality Assessment: Implement real-time monitoring of synthesis using fluorescent reporters

By systematically optimizing these parameters, researchers can achieve milligram-scale production of functional AQP3, representing a significant improvement over traditional expression systems that typically yield lower quantities . The cell-free approach provides unprecedented flexibility for rapid production of variants for structure-function studies.

How can recombinant AQP3 be utilized in biomimetic membrane technology?

Recombinant AQP3's unique water and glycerol transport properties make it valuable for several biomimetic applications:

Water Purification Membranes:
Incorporation of recombinant AQP3 into synthetic membranes can create highly efficient water filtration systems with dual functionality:

  • The water channel activity provides high water permeability while maintaining selectivity against ions and contaminants

  • The glycerol permeability allows controlled passage of specific beneficial solutes while rejecting others

Implementation approaches include:

  • Incorporation into block copolymer membranes that offer greater mechanical stability than lipid systems

  • Development of mixed-matrix membranes containing AQP3-proteoliposomes embedded in polymer supports

  • Creation of biomimetic membranes with oriented AQP3 channels for maximum efficiency

Controlled Release Systems:
AQP3's dual permeability can be exploited in drug delivery applications:

  • Design of vesicular systems that selectively release water-soluble or glycerol-soluble therapeutic agents

  • Development of responsive delivery systems where transport can be modulated by pH or inhibitors

  • Creation of compartmentalized reaction systems with controlled solute exchange

Biosensing Platforms:
Functional reconstitution of AQP3 enables development of novel sensing technologies:

  • Detection systems for glycerol and related compounds based on AQP3 transport activity

  • Osmotic pressure sensors utilizing the water permeability properties

  • Label-free detection platforms based on changes in AQP3 function upon binding of inhibitors or modulators

These biomimetic applications leverage the functional characteristics of recombinant AQP3 to address challenges in separation technology, controlled delivery, and sensing systems . The cell-free production approach enables scaling to quantities needed for these applications.

What role does recombinant AQP3 play in understanding skin hydration and wound healing mechanisms?

Recombinant AQP3 serves as a crucial tool for investigating the molecular mechanisms underlying skin hydration and wound healing processes:

Skin Hydration Studies:
AQP3 functions as a glycerol transporter in skin and plays a vital role in regulating stratum corneum (SC) and epidermal glycerol content . Recombinant AQP3 enables:

  • In vitro reconstitution experiments to quantify water and glycerol transport rates under controlled conditions

  • Structure-function studies to identify domains critical for glycerol transport in skin cells

  • Development of skin-relevant model systems to test hypothesized mechanisms of hydration maintenance

Wound Healing Investigations:
AQP3 is directly involved in wound healing processes , and recombinant protein studies help elucidate:

  • The role of glycerol transport in supporting cell migration during wound repair

  • Water channel function in maintaining proper osmotic balance during the inflammatory phase

  • Potential interactions between AQP3 and other proteins involved in wound healing cascades

Tissue Engineering Applications:
Recombinant AQP3 contributes to advanced skin tissue engineering through:

  • Development of hydrating matrices incorporating functional AQP3 for improved moisture retention

  • Creation of wound dressings with controlled water and glycerol delivery capabilities

  • Engineering of skin substitutes with enhanced barrier function through regulated water transport

Pharmacological Intervention Development:
Using recombinant AQP3 as a screening platform enables:

  • Identification of novel compounds that modulate AQP3 activity for dermatological applications

  • Testing of formulations designed to optimize skin hydration through AQP3-mediated mechanisms

  • Development of interventions for conditions characterized by impaired skin barrier function

These applications highlight how recombinant AQP3 serves as both a research tool for mechanistic understanding and a potential therapeutic target for skin conditions related to hydration and wound healing .

How can mutations in recombinant AQP3 provide insights into channel selectivity mechanisms?

Strategic mutations in recombinant AQP3 offer powerful tools for dissecting the molecular basis of its dual permeability to water and glycerol:

Selectivity Filter Modifications:
The AQP3 pore contains a distinctive selectivity region that determines which molecules can pass through the channel:

  • Mutations of key aromatic residues (phenylalanine, tyrosine) in the selectivity filter can alter the glycerol/water permeability ratio

  • Conversion of specific residues to mimic those found in water-selective aquaporins can reduce glycerol permeability

  • Introduction of charged residues at strategic positions can modify electrostatic interactions with passing solutes

Pore Size Determinants:
The dimensions of the AQP3 channel critically influence its transport properties:

  • Mutations that alter pore diameter through substitution with larger or smaller amino acids

  • Modifications to constriction regions that serve as "checkpoints" for molecular passage

  • Engineering of the extracellular and cytoplasmic vestibules that influence substrate entry

Functional Domain Analysis:
Systematic mutation of different protein regions reveals their contributions to channel function:

  • NPA motif variations that affect water orientation and hydrogen bonding during transport

  • Transmembrane domain modifications that influence channel stability and conformational dynamics

  • Loop region alterations that may impact channel gating or regulation

Comparative Mutational Analysis:
A particularly valuable approach involves creating chimeric constructs:

  • Hybrid proteins containing segments from water-selective aquaporins (AQP1) and aquaglyceroporins (AQP3)

  • Systematic exchange of domains between different aquaglyceroporins (AQP3, AQP7, AQP9)

  • Introduction of sequence variations observed in different species to identify evolutionarily conserved functional elements

The cell-free expression system is particularly advantageous for mutational studies as it allows rapid production and functional testing of multiple variants . These studies not only advance fundamental understanding of channel selectivity but also guide design of AQP3 variants with enhanced or modified properties for biotechnological applications.

What techniques can measure the impact of potential inhibitors on recombinant AQP3 function?

Comprehensive evaluation of AQP3 inhibitors requires multi-faceted approaches that assess both binding interactions and functional consequences:

Functional Transport Assays:
The gold standard for inhibitor assessment involves direct measurement of transport activity:

  • Stopped-Flow Light Scattering: Measures real-time changes in proteoliposome volume during water or glycerol transport, allowing precise determination of inhibition kinetics and IC₅₀ values

  • Radioactive Tracer Flux: Quantifies movement of labeled substrates (³H-glycerol) in the presence of inhibitors

  • Fluorescence-Based Assays: Utilizes volume-sensitive dyes to monitor transport inhibition in real-time

Binding Characterization:
Understanding the molecular interactions between inhibitors and AQP3:

  • Isothermal Titration Calorimetry (ITC): Provides direct measurement of binding thermodynamics

  • Surface Plasmon Resonance (SPR): Offers real-time analysis of binding kinetics and affinity

  • Microscale Thermophoresis (MST): Detects subtle changes in protein movement upon inhibitor binding

Structural Analysis:
Techniques that provide insight into inhibitor binding sites and mechanisms:

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Identifies regions of AQP3 protected by inhibitor binding

  • Computational Docking and Molecular Dynamics: Predicts binding modes and conformational changes

  • X-ray Crystallography or Cryo-EM (for stable complexes): Provides direct visualization of inhibitor-protein interactions

Comparative Inhibition Profiles:
A comprehensive inhibitor assessment should evaluate:

ParameterMethodologyKey Information
PotencyDose-response curvesIC₅₀ and Hill coefficient
SelectivityTesting against multiple AQPsSpecificity for AQP3 vs. other aquaporins
Mode of InhibitionKinetic analysisCompetitive, non-competitive, or mixed inhibition
ReversibilityWashout experimentsPersistence of inhibition after inhibitor removal
pH/Temperature DependencyAssays under varying conditionsRobustness of inhibition across conditions

The combination of these techniques provides a comprehensive profile of potential AQP3 inhibitors, guiding further development of compounds with improved potency, selectivity, and pharmacological properties . Such inhibitors serve as valuable research tools and potential therapeutic agents for conditions involving dysregulated AQP3 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.