Recombinant Human Aquaporin-9 (AQP9)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization and Production

Recombinant Human AQP9 is synthesized using eukaryotic expression systems (e.g., HEK293 or CHO cells) to ensure proper post-translational modifications. Key features include:

ParameterDetails
Molecular Weight31.3 kDa (unmodified)
GlycosylationN-linked glycosylation sites confirmed via PNGase F treatment
Purification TagsHis-tag or GFP fusion for detection and affinity chromatography
Solute PermeabilityGlycerol, urea, hydrogen peroxide, and water

Production involves cloning the AQP9 gene into plasmids (e.g., pEGFP-N1 or pGenesil-1) for transient or stable transfection. Functional validation includes osmotic permeability assays and immunoblotting .

Metabolic Regulation

  • Hepatic Glycerol Uptake: AQP9 is the primary glycerol channel in hepatocytes, critical for gluconeogenesis during fasting. Knockout mice exhibit elevated plasma glycerol (+300%) and triglycerides (+150%) .

  • Insulin Sensitivity: Hepatic AQP9 expression is inversely regulated by insulin, making it a potential target for diabetes management .

Immune and Infectious Disease Roles

  • Leukocyte Function: AQP9 facilitates neutrophil migration and dendritic cell maturation via F-actin polymerization .

  • Malaria Susceptibility: AQP9 is required for Plasmodium falciparum sporozoite entry into hepatocytes, highlighting its role as a host factor in malaria .

Pathological Associations

  • Non-Alcoholic Fatty Liver Disease (NAFLD): Downregulation of AQP9 in hepatoma cells reduces steatosis by limiting glycerol influx .

  • Cancer: Overexpression correlates with tumor progression in glioblastoma and leukemia via enhanced glycerol metabolism .

Research Tools and Inhibitors

Recombinant AQP9 is widely used to study transport kinetics and disease mechanisms. Notable tools include:

  • RG100204: A selective AQP9 inhibitor (IC₅₀ = 25 µM) that blocks glycerol transport in proteoliposomes and elevates plasma glycerol in db/db mice .

  • siRNA/shRNA Constructs: Effective knockdown reduces AQP9 mRNA by 45% in NAFLD models, mitigating lipid accumulation .

Therapeutic Potential

AQP9’s dual role in metabolism and immune response positions it as a biomarker and drug target:

  • Diabetes: Inhibiting hepatic AQP9 reduces gluconeogenesis, offering a strategy for glycemic control .

  • Inflammation: Targeting AQP9 in neutrophils may mitigate sepsis or autoimmune responses .

  • Infectious Diseases: Blocking AQP9 could prevent malaria liver-stage infection .

Key Research Findings

Study ModelKey OutcomeReference
AQP9 knockout miceImpaired hepatic glycerol metabolism
Plasmodium infectionAQP9 knockdown reduces hepatocyte entry
NAFLD cell modelsAQP9 downregulation prevents steatosis
RG100204 inhibitorConfirmed AQP9-specific blockade

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Kindly consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
AQP9; SSC1; Aquaporin-9; AQP-9; Aquaglyceroporin-9; Small solute channel 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-295
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
AQP9
Target Protein Sequence
MQPEGAEKGKSFKQRLVLKSSLAKETLSEFLGTFILIVLGCGCVAQAILSRGRFGGVITINVGFSMAVAMAIYVAGGVSGGHINPAVSLAMCLFGRMKWFKLPFYVGAQFLGAFVGAATVFGIYYDGLMSFAGGKLLIVGENATAHIFATYPAPYLSLANAFADQVVATMILLIIVFAIFDSRNLGAPRGLEPIAIGLLIIVIASSLGLNSGCAMNPARDLSPRLFTALAGWGFEVFRAGNNFWWIPVVGPLVGAVIGGLIYVLVIEIHHPEPDSVFKTEQSEDKPEKYELSVIM
Uniprot No.

Target Background

Function
AQP9 forms a water channel with broad specificity. It is also permeable to glycerol and urea. This protein mediates the passage of a wide range of small, non-charged solutes including carbamides, polyols, purines, and pyrimidines.
Gene References Into Functions
  1. Downregulation of AQP9 in cultured chondrocytes reduced the catabolic gene expression in response to IL1beta stimulation through nuclear factorkappaB signaling. PMID: 29901079
  2. AQP9, in conjunction with CLDN2, may play a role in regulating tissue-specific physiological properties in tight junctions in UC. Additionally, AQP9 may have a functional role in the synthesis and/or function of mucus. PMID: 29040430
  3. Research suggests that aquaporin-9 expression in term placenta is upregulated by leptin. These studies utilized placental explants following term birth via cesarean section. PMID: 28942694
  4. These findings indicate that eclamptic seizures induce cell death and that upregulation of AQP4 and AQP9 may play a significant role in this pathophysiological process. PMID: 29351212
  5. AQP9 transports two clinically important compounds for anticancer therapy, monomethyselenic acid and selenite. PMID: 28798983
  6. The identification of AQP9-induced tumor sensitivity to 5-Fluorouracil highlights its role in regulating chemosensitivity in colorectal cancer. PMID: 28640255
  7. AQP9 is downregulated in hepatocellular carcinoma, and its overexpression suppresses hepatoma cell invasion by inhibiting epithelial-to-mesenchymal transition. PMID: 27216981
  8. pH-dependent substrate permeability, measurements of media alkalization, and proton decoupling suggest that AQP9 acts as a channel for the protonated, neutral monocarboxylic acid species. PMID: 28360107
  9. AQP9 is involved in the activation of the ERK pathway in androgen-independent prostate cancer cells. PMID: 27187384
  10. Trophoblast from gestational diabetes expresses a higher amount of aquaporin 9. PMID: 27082037
  11. AQP9 decreases in hepatocellular carcinoma. Dibutrylyl cAMP increases AQP9 levels, suppressing tumor growth. PMID: 27022216
  12. Our findings suggest the involvement of AQP9 in H2O2 transport in human and mice cells. PMID: 26837049
  13. We propose that AQP9 is involved in viral tropism and pathogenesis of Herpes simplex encephalitis. PMID: 25604497
  14. AQP9 downregulation, along with the subsequent reduction in hepatic glycerol permeability in insulin-resistant states, emerges as a compensatory mechanism whereby the liver counteracts further triacylglycerol accumulation. PMID: 24418844
  15. AQP9-expressing glioma cells were negative for the brain tumor stem cell marker CD15. PMID: 24086629
  16. Placental expression of the arsenic transporter AQP9 was positively associated with maternal urinary arsenic levels during pregnancy. AQP9 expression was linked to phospholipase ENPP2 expression, which was positively associated with infant birth weight. PMID: 23866971
  17. Reduced expression of AQP9 in the human fallopian tube may contribute to aspects of the pathophysiology of tubal ectopic pregnancy. PMID: 23238960
  18. AQP9, rather than other biomarkers such as cell surface markers and chromosomal alterations, correlates closely with sensitivity to arsenic trioxide in acute promyelocytic leukemia cell lines. PMID: 23563754
  19. The identification of novel, high-affinity AQP9 inhibitors in an intracellular binding site has been made. PMID: 23448163
  20. The interplay of water fluxes through AQP9 and actin dynamics regulates the cellular protrusive and motile activity of cells. PMID: 23573219
  21. AQP9 expression is lower in patients with stage III colorectal cancer who do not respond to adjuvant chemotherapy. PMID: 23612070
  22. There is a coordinated regulation of adipose AQP7 and hepatic AQP9 gene expression that is distorted in metabolic syndrome X. (Review) PMID: 22425521
  23. Multi-tissue gene expression studies reveal SERPINA1 and AQP9 variants as genes for atherosclerosis. PMID: 22916037
  24. Using transcriptional signatures of blood samples, S100A11 was identified as a potential diagnostic marker of infective endocarditis, and AQP9 as a potential prognostic factor. PMID: 22319637
  25. Aquaporin 9 is linked to the tumorigenesis of glioblastoma. PMID: 22262958
  26. The expression levels of aquaporin 9 were approximately 2 times higher in the chorion cells than those in the amnion cells following arsenite administration. PMID: 21945491
  27. AQP9 plays an active role in neutrophil volume regulation and migration. PMID: 21873454
  28. Elevated serum levels of human chorionic gonadotrophin may be involved in increased aquaporin-9 protein expression in preeclamptic placenta explants via adenosine 3',5'-cyclic phosphate pathways. PMID: 20220109
  29. Genetic variation in the AQP9 gene is associated with femoral neck BMD in postmenopausal women, and may represent one of the susceptibility genes for phenotypes related to bone mass. PMID: 20960106
  30. Insulin treatment inhibited the expression of AQP9 in normal liver cells. PMID: 20587318
  31. Hyperandrogenism in follicular fluid of women with polycystic ovary syndrome inhibited AQP-9 in granulosa cells through the PI3K pathway. PMID: 20378617
  32. The examination was performed to determine whether aquaporin (AQP) 9 is expressed in normal skeletal muscle at mRNA and protein levels. PMID: 19629726
  33. The results suggest that in addition to the initial uptake of trivalent inorganic As(III) inside cells, AQP9 plays a dual role in the detoxification of arsenic metabolites by facilitating efflux from cells. PMID: 19802720
  34. AQP9 expression in fetal membranes was significantly higher in spontaneous term labor when compared with term-not in labor membranes. PMID: 19916714
  35. AQP9 can modulate drug sensitivity in cancer. PMID: 15336539
  36. The APQ9 mRNA expression in fetal membranes suggests that APQ9 may be an important water channel in intramembranous amniotic fluid water regulation. PMID: 15592307
  37. Results provide new evidence suggesting the involvement of AQP9 and UT-A in the urea excretion mechanism across the human term placenta from mother to fetus in physiological conditions. PMID: 16480766
  38. We propose that increased water influx through AQP9 is critically involved in the formation of membrane protrusions, and that AQP9-induced actin polymerization is augmented by activation of Cdc42 and PKC(zeta). PMID: 17346701
  39. The expression of AQP9 in glioblastoma was studied. PMID: 17525633
  40. Decreased hepatic AQP9 expression observed in obese T2DM subjects suggests a potential role in glycerol release from adipose tissue. PMID: 18401671
  41. Results indicate that aquaporin-9 may play an important role in the malignant progression of brain astrocytic tumors. PMID: 18652774
  42. hAQP9 functions as a facilitative carrier for glycerol. PMID: 18762715
  43. The present study strongly suggests that membrane transporters responsible for arsenic uptake, such as AQP9, may play a critical role in the development of arsenic resistance in human lung cancer cells. PMID: 19100828
  44. CFTR expression decreases in preeclampsia and may thus be implicated in the regulation of AQP9 activity. PMID: 19481256
  45. We found a greater expression in visceral fat, and a correlation between subcutaneous adipose aquaporin 7 and hepatic AQP9 gene expression within the context of human morbid obesity. PMID: 19615702

Show More

Hide All

Database Links

HGNC: 643

OMIM: 602914

KEGG: hsa:366

STRING: 9606.ENSP00000219919

UniGene: Hs.104624

Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in peripheral leukocytes. Also expressed in liver, lung, and spleen.

Q&A

What is the molecular structure of human AQP9?

Aquaporin-9 (AQP9) exhibits a tetrameric structure similar to other members of the aquaporin family. Each monomer forms a distinct pore for solute transport. Single particle electron microscopy analysis of negatively stained recombinant AQP9 reveals square-shaped particles with a side length of approximately 70 Å, which correlates well with the dimensions of other aquaporins (such as the 68 Å side length observed in AQP1 tetramers) .

Projection mapping at 7 Å resolution shows that AQP9 monomers have a squarish shape similar to GlpF (glycerol facilitator) rather than the wedge-shaped structure of pure water pores like AQP1 or AQP0. The AQP9 pore appears oval with approximate dimensions of 7 Å by 12 Å, compared to the round 7 Å diameter pore in GlpF, suggesting structural adaptations for its broader substrate specificity .

How does AQP9 differ from other aquaporins in terms of substrate selectivity?

AQP9 belongs to the aquaglyceroporin subfamily and demonstrates unusually broad substrate selectivity compared to other aquaporins. While all aquaglyceroporins can transport water, glycerol, and urea, AQP9 uniquely facilitates the transmembrane transport of additional larger molecules including:

  • Hydrogen peroxide (H₂O₂)

  • Lactate

  • Mannitol

  • Ammonia

  • Arsenite

  • Selenite

  • 5-fluorouracil

This broader substrate specificity appears to be related to structural differences in the pore region. Homology modeling comparing AQP9 with GlpF shows that while the central constriction region (containing conserved residues like Gly 80, His 82, Asn 84, Asn 216, and Arg 219 in rat AQP9) remains preserved, AQP9 exhibits substitutions predominantly in the hydrophobic edge of the tripathic pore. These modifications, particularly near the pore openings, may facilitate easier access for larger solutes .

What are the transport kinetics of recombinant human AQP9?

While specific kinetic parameters are not directly provided in the search results, research indicates that AQP9's transport mechanisms involve:

  • Size-selective filtration through aromatic/arginine residues (ar/R constriction site) near the extracellular vestibule, with a pore size of approximately 3.4 Å for aquaglyceroporins like AQP9 compared to 2.8 Å for classical aquaporins

  • Charge-selective filtration through two preserved NPA motifs that act as dipoles to prevent ion permeation

  • A similar proton exclusion mechanism as other aquaporins, despite the ability to transport larger solutes

For larger solutes to permeate the AQP9 constriction site, researchers hypothesize that a solute-induced conformational change occurs in the pore region, similar but larger than what has been observed in molecular dynamics simulations of glycerol permeating the GlpF pore .

What are the optimal expression systems for producing recombinant human AQP9?

Based on the search results, recombinant human AQP9 has been successfully produced using:

  • HEK293T cells: This human cell line has been used for commercial production of recombinant human AQP9 protein, as indicated in search result . This system provides proper post-translational modifications and likely produces correctly folded human AQP9.

  • E. coli systems: While not explicitly mentioned for human AQP9, the search results suggest that bacterial expression systems have been used for other aquaporins like GlpF .

For optimal expression, researchers should consider:

  • Using mammalian expression systems when native post-translational modifications are critical

  • Including appropriate tags (such as C-Myc/DDK tags mentioned in result ) to facilitate purification

  • Storage in stabilizing buffers (e.g., 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol) to maintain protein integrity

What purification methods yield the highest quality recombinant AQP9 for structural studies?

For structural studies requiring high-purity recombinant AQP9, the following methodological approach is recommended based on research protocols:

  • Expression system selection: HEK293T cells have been successfully used to produce recombinant human AQP9 suitable for downstream applications .

  • Detergent extraction: Proper detergent selection is crucial for membrane protein purification. For electron microscopy studies, detergents must be carefully managed - researchers have found that washing with deionized water prior to staining with uranyl formate improves visualization of AQP9 tetramers .

  • Purification assessment: Single particle electron microscopy can be used to assess the quality of AQP9 preparations and determine suitability for two-dimensional (2D) crystallization trials. High-quality preparations should show mono-disperse particles homogeneous in size .

  • 2D crystallization: Reconstitution of purified AQP9 into two-dimensional crystals enables higher-resolution structural analysis. This approach has enabled projection mapping at 7 Å resolution .

  • Quality control: Protein concentration and purity can be assessed using microplate BCA method, with quality preparations showing concentrations >50 μg/mL .

How can I optimize transfection efficiency for recombinant AQP9 expression in mammalian cell lines?

While the search results don't provide specific transfection protocols for AQP9, researchers working with recombinant membrane proteins like AQP9 should consider:

  • Vector selection: Vectors with strong promoters appropriate for the host cell line. For example, commercially available AQP9 is produced using expression vectors that include C-Myc/DDK tags .

  • Cell density optimization: Transfection at 70-80% confluency is typically optimal for HEK293T cells.

  • Transfection reagent selection: Lipid-based transfection reagents often work well for aquaporin expression in mammalian cells.

  • Expression verification: Western blotting using antibodies against the protein or tags (such as the C-Myc/DDK tags mentioned ) to confirm expression.

  • Functional verification: Water or glycerol permeability assays to confirm functionality of the expressed recombinant AQP9.

What experimental approaches can be used to study AQP9 permeability to diverse substrates?

Several experimental approaches can be employed to investigate AQP9's diverse substrate permeability:

  • Reconstitution in proteoliposomes: Purified recombinant AQP9 can be incorporated into lipid vesicles to measure transport rates of various substrates under controlled conditions.

  • Xenopus oocyte expression system: This system has been widely used for functional characterization of aquaporins, allowing measurement of substrate-induced volume changes or substrate uptake.

  • Cell-based permeability assays: Cells expressing recombinant AQP9 can be used to measure:

    • Water permeability using stopped-flow light scattering

    • Glycerol permeability using radiolabeled glycerol

    • Hydrogen peroxide transport using H₂O₂-sensitive fluorescent probes

  • Molecular dynamics simulations: Computational approaches using homology models of AQP9 can provide insights into substrate specificity and transport mechanisms. This approach has been used to pinpoint structural features determining glycerol permeability in aquaporins and could be extended to study AQP9's broader substrate range .

  • Pore mutation studies: Site-directed mutagenesis of residues lining the AQP9 pore, particularly those in the hydrophobic edge that differ from other aquaporins, can help identify key residues responsible for specific substrate transport .

How can I differentiate between AQP9-mediated transport and passive diffusion in experimental systems?

Differentiating AQP9-mediated transport from passive diffusion requires careful experimental design:

  • Control experiments: Compare substrate transport rates in:

    • Cells/vesicles expressing AQP9

    • Identical systems without AQP9 expression

    • Systems expressing non-functional AQP9 mutants

  • Inhibitor studies: Use mercury compounds (HgCl₂) which inhibit aquaporin function by binding to cysteine residues. A reduction in transport upon mercury treatment that is recoverable with reducing agents suggests aquaporin-mediated transport.

  • Temperature dependence: AQP9-mediated transport shows lower activation energy compared to passive diffusion across membranes. Measuring transport rates at different temperatures can help distinguish between mechanisms.

  • pH sensitivity studies: AQP9 function may be affected by pH changes, while passive diffusion is generally less sensitive to pH.

  • Knockdown/knockout approaches: Use of siRNA or CRISPR-Cas9 to reduce or eliminate AQP9 expression provides another method to confirm AQP9-specific transport. The search results mention studies using Aqp9⁻/⁻ knockout mice to study AQP9's role in brain inflammatory response .

How does AQP9 transport of hydrogen peroxide relate to its role in oxidative stress responses?

AQP9's ability to transport hydrogen peroxide (H₂O₂) positions it as a key player in cellular redox balance and oxidative stress responses:

  • Peroxiporin activity: AQP9 functions as a peroxiporin by facilitating H₂O₂ diffusion across membranes . This transport capacity has important implications for:

    • Redox signaling pathways

    • Oxidative stress responses

    • Cell survival during inflammatory conditions

  • Liver metabolism: AQP9 is most highly expressed in the liver, where it contributes to both metabolic and redox balance through its dual aquaglyceroporin and peroxiporin activities . This suggests AQP9 may play a role in:

    • Protecting hepatocytes during oxidative stress

    • Regulating redox-dependent metabolic processes

    • Mediating inflammatory responses in liver injury

  • Immune cell function: AQP9 expression in immune cells affects their response to oxidative environments:

    • In macrophages, AQP9 expression increases and the protein redistributes to leading and trailing regions following infection with Pseudomonas aeruginosa

    • AQP9 is involved in macrophage M2 polarization in kidney renal clear cell carcinoma

    • In CD8+ T cells, AQP9 is required for longevity, fast response to rechallenge, and cell locomotion in tumor microenvironments

These findings suggest that AQP9-mediated H₂O₂ transport may be crucial for immune cell function in inflammatory and oxidative stress conditions.

What is the evidence for AQP9's role in non-alcoholic fatty liver disease (NAFLD)?

Research indicates AQP9 plays a significant role in non-alcoholic fatty liver disease (NAFLD) pathogenesis:

  • AQP9 in hepatic glycerol metabolism: As the primary aquaglyceroporin expressed in liver cells, AQP9 is localized at the sinusoidal plasma membrane facing the portal vein, making it a critical channel for glycerol uptake from the bloodstream . This glycerol serves as a substrate for triglyceride synthesis in the liver.

  • Relationship to hepatic steatosis: In NAFLD, excess triglycerides accumulate in hepatocytes (simple steatosis) . The main sources of these triglycerides are:

    • Fatty acids stored in adipose tissue

    • De novo lipogenesis of fatty acids within the liver

  • Experimental evidence: Research has demonstrated that downregulation of AQP9 prevents steatosis in oleic acid-induced NAFLD cell models , suggesting that:

    • Reducing glycerol uptake through AQP9 can limit triglyceride synthesis

    • AQP9 inhibition could represent a potential therapeutic strategy for NAFLD

This evidence positions AQP9 as a promising target for NAFLD treatment, especially given the current lack of effective pharmacological interventions for this condition .

How does AQP9 contribute to neuroinflammatory processes?

AQP9 appears to play a proinflammatory role in the brain, similar to its function in peripheral tissues:

  • Expression in CNS: AQP9 is expressed in the brain, though at lower levels than in the liver .

  • Experimental evidence: Studies using Aqp9⁻/⁻ knockout mice have investigated AQP9's role in brain inflammatory responses . These experiments suggest AQP9 may influence:

    • Microglial activation

    • Neuroinflammatory signaling

    • Brain immune cell responses

  • Mechanistic hypotheses: While not explicitly detailed in the search results, AQP9's ability to transport hydrogen peroxide may be relevant to its neuroinflammatory role, as H₂O₂ is an important signaling molecule in inflammatory processes and oxidative stress responses .

  • Potential implications: Understanding AQP9's role in neuroinflammation could be relevant for:

    • Neurodegenerative diseases with inflammatory components

    • Neurological conditions involving oxidative stress

    • Potential therapeutic strategies targeting brain inflammation

Further research is needed to fully elucidate the specific mechanisms by which AQP9 influences neuroinflammatory processes.

What experimental models are most appropriate for studying AQP9 in cancer research?

Based on the search results, several experimental models are appropriate for investigating AQP9's role in cancer:

  • Genetic knockout models:

    • Aqp9⁻/⁻ mice have been used to study AQP9's biological functions

    • These models allow comparison between wild-type and AQP9-deficient conditions in vivo

  • Cell culture models:

    • Human cell lines expressing endogenous or recombinant AQP9

    • Cancer cell lines with AQP9 knockdown or overexpression

  • Tumor microenvironment studies:

    • Models examining CD8+ T cell infiltration into tumors, as AQP9 has been shown to be required for T cell locomotion to reach the tumor microenvironment

    • Systems investigating macrophage polarization in cancer contexts, given AQP9's involvement in M2 polarization in kidney renal clear cell carcinoma

  • Patient-derived samples:

    • Analysis of AQP9 expression in cancer tissues compared to normal tissues

    • Correlation of AQP9 expression with clinical outcomes and patient survival

These models can help elucidate AQP9's potential as a biomarker or therapeutic target in various cancers, including kidney renal clear cell carcinoma where its role in immune cell polarization has been documented .

How can molecular dynamics simulations enhance our understanding of AQP9 substrate selectivity?

Molecular dynamics (MD) simulations offer powerful approaches to investigate AQP9's unique substrate selectivity:

  • Structural basis for transport: MD simulations can examine how AQP9's pore architecture differs from other aquaporins, particularly focusing on:

    • The hydrophobic edge of the tripathic pore where most amino acid substitutions occur

    • Potential conformational changes during transport of larger solutes

    • Energetics of substrate passage through the pore

  • Substrate-induced conformational changes: For larger solutes to pass through AQP9's constriction site, researchers hypothesize that substrate-induced conformational changes occur, similar to but larger than those seen in simulations of glycerol permeating the GlpF pore . MD simulations can model these dynamics.

  • Homology model refinement: Existing homology models of AQP9 based on GlpF (which shares 38% identity with AQP9) can be refined through MD simulations to better understand:

    • How conserved pore residues (Gly 80, His 82, Asn 84, Asn 216, and Arg 219 in rat AQP9) contribute to transport specificity

    • How non-conserved residues in the hydrophobic face allow transport of larger solutes

  • Proton exclusion mechanisms: MD simulations can investigate how AQP9 maintains proton exclusion despite its broader substrate specificity , potentially revealing unique adaptations in its channel architecture.

What are the challenges in developing AQP9-specific inhibitors for research applications?

Developing AQP9-specific inhibitors presents several significant challenges:

  • Structural similarities: AQP9 shares structural similarities with other aquaporins, particularly aquaglyceroporins, making selectivity difficult to achieve. The conserved central constriction region across aquaporins creates challenges for developing inhibitors that target only AQP9 .

  • Limited structural data: While projection mapping at 7 Å resolution provides valuable insights , higher-resolution structural data (ideally atomic resolution) would significantly enhance inhibitor design efforts.

  • Complex substrate selectivity: AQP9's ability to transport diverse substrates indicates a flexible or adaptable pore structure , which may complicate inhibitor design as different conformational states may need to be considered.

  • Expression pattern considerations: AQP9 is expressed in multiple tissues, including liver, brain, and immune cells , requiring careful consideration of off-target effects when developing inhibitors for research applications.

  • Validation challenges: Testing inhibitor specificity requires:

    • Comparing effects across multiple aquaporin subtypes

    • Distinguishing between direct inhibition and secondary effects

    • Developing appropriate assays for diverse substrates

These challenges underscore the need for interdisciplinary approaches combining structural biology, medicinal chemistry, and functional assays to develop useful AQP9-specific inhibitors.

How can contradictions in reported AQP9 expression patterns across different tissues be reconciled?

Reconciling contradictory reports of AQP9 expression requires careful methodological consideration:

  • Methodological differences: Variations in detection methods can cause apparent contradictions:

    • mRNA vs. protein detection (transcriptional vs. translational regulation)

    • Antibody specificity issues (cross-reactivity with other aquaporins)

    • Sensitivity differences between methods

  • Species differences: AQP9 expression patterns may vary between species (human, mouse, rat), requiring careful attention to the specific species being studied in each report .

  • Physiological conditions: AQP9 expression is dynamically regulated by:

    • Inflammatory stimuli (as seen in macrophages during infection)

    • Metabolic state (relevant to its role in liver metabolism)

    • Disease contexts (expression changes in conditions like NAFLD or cancer)

  • Cell-type specificity: Within tissues, AQP9 may be expressed in specific cell populations. For example, in the liver, AQP9 is localized at the sinusoidal plasma membrane of hepatocytes facing the portal vein , while in the brain, expression patterns may be restricted to certain cell types.

  • Subcellular redistribution: AQP9 can redistribute within cells in response to stimuli (as seen in macrophages after infection) , potentially affecting detection depending on the method used.

Researchers should address these factors through:

  • Clear reporting of experimental conditions

  • Use of multiple detection methods

  • Careful consideration of species differences

  • Inclusion of appropriate positive and negative controls

What are the optimal storage conditions for maintaining recombinant AQP9 stability?

Based on available information about commercially produced recombinant human AQP9, the following storage conditions are recommended:

  • Temperature: Store at -80°C for long-term stability .

  • Buffer composition: The optimal buffer for recombinant AQP9 storage appears to be:

    • 25 mM Tris.HCl, pH 7.3

    • 100 mM glycine

    • 10% glycerol

  • Handling recommendations:

    • Avoid repeated freeze-thaw cycles which can compromise protein integrity

    • Ship on dry ice to maintain frozen state during transport

    • Aliquot before freezing to minimize freeze-thaw cycles

  • Stability assessment: Properly stored recombinant AQP9 should remain stable for approximately 12 months from receipt when maintained under appropriate conditions .

What methodological approaches can address the challenges of AQP9 crystallization for high-resolution structural studies?

High-resolution structural studies of AQP9 face challenges due to its membrane protein nature. Based on the search results, the following methodological approaches can address these challenges:

  • Two-dimensional (2D) crystallization: This approach has successfully yielded a projection map of AQP9 at 7 Å resolution . Key considerations include:

    • Optimization of lipid composition for reconstitution

    • Careful detergent removal protocols

    • Screening of crystallization conditions (pH, temperature, ionic strength)

  • Single particle analysis: This method revealed AQP9's tetrameric organization prior to 2D crystallization . Important methodology notes include:

    • Removal of detergent by washing with deionized water prior to staining improves visualization

    • Negative staining with uranyl formate provides good contrast

    • Classification of particles (6,220 particles classified into 24 groups was effective)

  • Three-dimensional crystallization: While not reported in the search results, approaches that have worked for other aquaporins may be applicable:

    • Lipidic cubic phase crystallization

    • Antibody-mediated crystallization

    • Fusion protein approaches to improve crystal contacts

  • Cryo-electron microscopy: This emerging technique for membrane proteins could potentially provide higher-resolution structural data without crystallization requirements.

  • Computational approaches: Homology modeling has been used successfully to gain insights into AQP9 structure based on the GlpF crystal structure (38% identity) . These models can be refined using:

    • Molecular dynamics simulations

    • Integration with low-resolution experimental data

    • Evolutionary coupling analysis

How can researchers differentiate between the various functions of AQP9 in complex biological systems?

Differentiating between AQP9's multiple functions (water transport, glycerol transport, H₂O₂ transport, etc.) in complex biological systems requires sophisticated experimental designs:

  • Substrate-specific transport assays:

    • Water permeability: Cell swelling/shrinking rates in hypotonic/hypertonic conditions

    • Glycerol transport: Radiolabeled glycerol uptake or glycerol-induced volume changes

    • H₂O₂ transport: H₂O₂-sensitive fluorescent probes or redox-sensitive reporters

  • Selective inhibition approaches:

    • Site-directed mutagenesis targeting residues specific to certain substrate transport

    • Development of substrate-specific inhibitors

    • Use of competitive inhibitors for specific transport functions

  • Function-specific readouts in disease models:

    • For metabolic functions: Measure triglyceride synthesis in liver cells with and without AQP9

    • For immune functions: Assess macrophage polarization or T cell locomotion

    • For redox functions: Measure oxidative stress markers or redox signaling outputs

  • Genetic manipulation with function-specific complementation:

    • Use AQP9 knockout models (like the Aqp9⁻/⁻ mice mentioned in )

    • Complement with AQP9 variants with mutations affecting specific transport functions

    • Assess rescue of specific phenotypes to determine which AQP9 function is critical

  • Tissue-specific and conditional expression systems:

    • Use tissue-specific or inducible promoters to control AQP9 expression

    • Temporal control of expression to separate developmental from acute functions

    • Spatial regulation to differentiate between functions in different tissues or cell types

These approaches, used in combination, can help researchers dissect the complex multifunctional nature of AQP9 in biological systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.