Recombinant Human Arachidonate 5-lipoxygenase-activating protein (ALOX5AP)

Shipped with Ice Packs
In Stock

Description

Biological Role and Mechanism

ALOX5AP anchors 5-lipoxygenase (5-LO) to the nuclear membrane, facilitating the conversion of arachidonic acid into pro-inflammatory leukotrienes (LTs) . Its structure comprises four transmembrane helices forming a trimeric barrel, critical for substrate binding and enzyme activation . Key functions include:

  • Leukotriene Biosynthesis: Essential for producing LTB₄, LTC₄, and pro-resolving lipoxins .

  • Arachidonic Acid Transfer: Acts as a scaffold for 5-LO, enhancing its catalytic efficiency .

  • Inflammatory Signaling: Overexpressed in adipose tissue during obesity, contributing to insulin resistance and hepatic steatosis .

Disease Associations

  • Cardiovascular Risks: Genetic variants of ALOX5AP correlate with myocardial infarction, stroke, and atherosclerosis .

  • Metabolic Disorders: FLAP overexpression in obesity drives adipose tissue inflammation and systemic lipid dysfunction .

  • Respiratory Diseases: Leukotrienes mediate asthma and allergic responses, making FLAP a therapeutic target .

Inhibitor Development

InhibitorTargetClinical RelevanceReference
MK-886FLAPBlocks LT synthesis; anti-inflammatory
VeliflaponFLAPPhase III trials for cardiovascular disease
BAY X1005FLAPReduces hepatic steatosis in obese models
Compound 5FLAP/sEH dualNovel anti-inflammatory candidate

Dual FLAP/sEH inhibitors (e.g., Compound 5) show enhanced anti-inflammatory effects by simultaneously elevating anti-inflammatory EETs and suppressing LTs .

Research Findings

  • Structural Insights: FLAP’s trimeric barrel structure (60 Å height, 36 Å width) provides a blueprint for inhibitor design .

  • Functional Studies: FLAP inhibition reduces NF-κB activation and pro-inflammatory adipokines (e.g., TNF-α, IL-6) in obese adipose tissue .

  • Therapeutic Potential: Pharmacophore-based virtual screening identified novel FLAP inhibitors with IC₅₀ values as low as 200 nM .

Technical Validation

  • Activity Assays: Recombinant ALOX5AP retains functionality in cell-based LT synthesis assays .

  • Antibody Compatibility: Validated for use in Western blotting, ELISA, and immunohistochemistry .

  • Species Cross-Reactivity: Conserved across humans, mice, and rats, enabling translational studies .

Product Specs

Buffer
For liquid delivery forms, the default storage buffer is Tris/PBS-based, containing 5%-50% glycerol.

Note: If you have specific requirements for the glycerol content, please indicate them when placing your order.

If the delivery form is lyophilized powder, the buffer used before lyophilization is Tris/PBS-based, containing 6% Trehalose.

Form
The delivery form can be either liquid or lyophilized powder.

Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them when placing your order, and we will prepare accordingly.

Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery time information.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your preparation.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.

Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 6xHis-SUMO-tagged
Synonyms
ALOX5AP; FLAP; Arachidonate 5-lipoxygenase-activating protein; MK-886-binding protein
Datasheet & Coa
Please contact us to get it.
Expression Region
1-161aa
Mol. Weight
34.2 kDa
Protein Length
Full Length
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Cardiovascular
Source
in vitro E.coli expression system
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
ALOX5 activating protein (ALOX5AP), also known as 5-lipoxygenase-activating protein (FLAP), is essential for leukotriene biosynthesis by ALOX5 (5-lipoxygenase). It anchors ALOX5 to the membrane, binds arachidonic acid, and may play a crucial role in transferring arachidonic acid to ALOX5. ALOX5AP also binds to MK-886, a compound that inhibits leukotriene biosynthesis.
Gene References Into Functions
  1. Phosphate steering is a critical but often overlooked function of FLAP that ensures 5'-flap specificity and catalysis, preventing genomic instability. PMID: 28653660
  2. A meta-analysis suggests that ALOX5AP rs17222919-1316T/G may serve as a protective factor against stroke. PMID: 30313062
  3. No significant association was observed between ALOX5AP rs10507391 polymorphism and ischemic stroke risk in males. Furthermore, this polymorphism was not linked to cardioembolic ischemic stroke risk. PMID: 29096760
  4. rs17222919 of ALOX5AP is a potential genetic protective factor against ischemic stroke in the Chinese population. PMID: 27416969
  5. Research findings indicate that SNP genetic variants of ALOX5AP might play a role in the development of SSc-related pulmonary fibrosis and ventilatory dysfunction. PMID: 28160477
  6. Meta-analysis suggests that the A allele at the ALOX5AP SG13S114 polymorphism is a protective factor for ischemic stroke in the European population. PMID: 28101761
  7. Genetic polymorphisms of T-1131C APOA5 and ALOX5AP SG13S114 can be considered risk factors for the susceptibility to ischemic stroke in Morocco. PMID: 27350673
  8. Data indicates that a single amino acid mutation was sufficient to reverse the speciation observed in wild type 5-Lipoxygenase activating protein (FLAP). PMID: 27129215
  9. No association was found between single-nucleotide polymorphisms of ALOX5AP or PDE4D and the risk of overall ischemic stroke in a southeastern Chinese population. However, the ALOX5AP gene might be related to ischemic stroke incidence in females. PMID: 24485247
  10. Genetic interaction of CD80 and ALOX5AP was observed in systemic lupus erythematosus in Asian populations. PMID: 25862617
  11. findings show that several enzymes known to be involved in the biosynthesis of proinflammatory LTs, such as FLAP and cPLA2alpha, also contribute to LX and Rv formation PMID: 26289316
  12. The results of this study supported the association of the epistatic interactions of ALOX5AP, THBD, and KNG1 and present novel evidence for the main effect of KNG1 gene on IS susceptibility PMID: 26159646
  13. results of the meta-analysis indicate that ALOX5AP rs10507391/SG13S114 A>T polymorphism is not associated with the risk of cerebral infarction in the Chinese population. PMID: 25242267
  14. Genetic polymorphisms of ALOX5AP and CYP3A5 increase susceptibility to ischemic stroke and are associated with atherothrombotic events in stroke patients. PMID: 25534367
  15. Our study provides evidence that the promoter single nucleotide polymorphism (SNP) rs17222919 of the ALOX5AP is a potential genetic protective factor for IS in the Chinese Han population. PMID: 25815512
  16. Report no association between ALOX5AP SNPs and atherosclerotic plaque phenotypes. PMID: 25721704
  17. FLAP protein inhibition attenuates inflammation induced by lipopolysaccharides (LPS) or the lipid A fraction of LPS. PMID: 25025775
  18. Rs10507391, rs4769874 and its haplotypes in ALOX5AP are unrelated to ACS risk in the Chinese Han population of Changwu, but elevated serum LTB4 level is strongly associated with acute coronary syndrome risk PMID: 25210744
  19. A common genetic variant SG13S114/AA in ALOX5AP was associated with ischemic stroke in a Chinese cohort. PMID: 24198186
  20. BRP-7 potently suppresses leukotriene biosynthesis by interacting with FLAP in human neutrophils/monocytes. PMID: 24641614
  21. ALOX5AP polymorphisms are associated with atherosclerotic cerebral infarction in a cigarette smoking Chinese population. PMID: 24411318
  22. This study showed that interactions between the ALOX5AP SG13S114 and CYP3A5 A6986G genes can engender a significantly higher risk of stroke than a single risk factor. PMID: 24368493
  23. There was no statistically significant association of ALOX5AP rs4073259 SNP with ischemic stroke in this northeastern Chinese Han population living in Heilongjiang province, China. PMID: 24635928
  24. This meta-analysis identifies three polymorphisms of ALOX5AP that are significantly associated with risk for the Chinese population to develop ischemic stroke. PMID: 24183033
  25. a protective role of the three ALOX5AP SNPs for stroke PMID: 25010723
  26. The cellular biosynthesis of 5-LO products from endogenously derived substrate requires not only functional 5-LO/FLAP co-localization but also additional prerequisites which are dispensable when exogenous AA is supplied PMID: 24905297
  27. The roles of CLP and FLAP in in cellular leukotriene biosynthesis, were studied. PMID: 25034252
  28. The two genetic polymorphisms of ALOX5AP, SG13S114 and SG13S32, are not associated with cerebral infarction. PMID: 23546934
  29. The results of our study failed to confirm whether the selected variants in ALOX5AP gene within the LT metabolism pathway contribute to platelet reactivity in a diabetic population treated with ASA. PMID: 23828562
  30. ALOX5AP SG13S114 polymorphism is associated with susceptibility to ischemic stroke in Chinese population. [review] PMID: 24148560
  31. the interaction between ALOX5AP-SG13S114AA and COX-2-765CC apparently increases susceptibility to cerebral infarction. PMID: 23765972
  32. Genetic variability in FLAP and ALOX15 may modify the protective effect of NSAID use against colorectal neoplasia. PMID: 23404351
  33. Data indicate that single-nucleotide polymorphisms (SNPs) in 5-lipoxygenase activating protein (ALOX5AP), phosphodiesterase 4D (PDE4D), and interleukin-1alpha (IL-1alpha) were associated with an increased risk of atherothrombotic stroke (ATS) in Chinese. PMID: 23076369
  34. The ALOX5AP SNP A allele in rs4073259 and genotype rs9579646 GG, rs9551963 AC, and haplotype rs9315050 & rs9551963 AAAC were associated with an increased risk of ischemic stroke. PMID: 22849376
  35. SNP haplotypes with susceptibility to coronary artery disease in a Chinese Han population PMID: 22726381
  36. study is the first to demonstrate the association between lung function and ALOX5AP polymorphisms in a healthy and general population PMID: 22537113
  37. Our data do not support the hypothesis that variants in ALOX5AP are associated with risk of MRI-defined brain infarcts. PMID: 22074807
  38. This study provides preliminary evidence suggesting that genetic polymorphisms of ALOX5AP are associated with atherothrombotic stroke. PMID: 22051033
  39. ALOX5AP SNPs are unlikely to play a dominant role in the pathogenesis of abdominal aortic aneurysms. PMID: 22129473
  40. The polymorphisms spanning ALOX5AP is not major determinants of baseline lung function in smokers. PMID: 22206291
  41. Genetic variants in the promoter region of the ALOX5AP gene might be a novel genetic risk factor for ischemic stroke in a north Chinese Han population. PMID: 21893978
  42. These results suggested that the genetic variants in ALOX5AP might modulate the risk of stroke in Eastern Chinese Han population. PMID: 21153769
  43. A Promoter polymorphism (rs17222919, -1316T/G) of ALOX5AP is associated with intracerebral hemorrhage in Korean population PMID: 21816595
  44. No statistically significant associations were found between acute stroke and the ALOX5AP gene polymorphisms examined PMID: 21675249
  45. Polymorphisms of the 5-lipo-oxygenase-activating protein may be associated with chronic spontaneous urticaria. PMID: 21227888
  46. Data show that the HapB haplotype and rs1722842 polymorphism in ALOX5AP gene were associated with coronary heart disease, and the HapA haplotype was associated with risk of MI. PMID: 21199733
  47. The polymorphism of SG13S114A/T in ALOX5AP is not related with atherosclerotic cerebral infarction. PMID: 20014490
  48. LTA4H and ALOX5AP gene polymorphisms modify the augmentation of bronchodilator responsiveness by leukotriene modifiers in Puerto Ricans but not Mexicans with asthma. PMID: 20810156
  49. Our results support the role of LTA4H and ALOX5AP variants as risk factors for asthma in Latino populations. PMID: 20067482
  50. The ALOX5AP SG13S114 variant is an independent risk factor for ischemic stroke in the Iberian population and is associated with ALOX5AP expression levels PMID: 20357438

Show More

Hide All

Database Links

HGNC: 436

OMIM: 601367

KEGG: hsa:241

STRING: 9606.ENSP00000369858

UniGene: Hs.507658

Involvement In Disease
Ischemic stroke (ISCHSTR)
Protein Families
MAPEG family
Subcellular Location
Nucleus membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

  • How can researchers optimize the production of functional recombinant ALOX5AP for structural and interaction studies?

Producing functional recombinant ALOX5AP presents several challenges due to its nature as a transmembrane protein with multiple helices. Based on current research methodologies, the following optimized approach is recommended:

Expression Systems:
Multiple expression systems have been used successfully, each with specific advantages:

  • E. coli system: Suitable for producing N-terminal 6xHis-SUMO-tagged ALOX5AP (full length, 1-161aa)

  • Yeast: Provides eukaryotic post-translational modifications

  • Baculovirus: Better for complex membrane proteins

  • Mammalian cell expression: Offers the most native-like environment

Construct Design:

  • Include the complete sequence (161 amino acids) covering all four transmembrane domains

  • N-terminal tags (6xHis-SUMO) improve solubility and purification

  • For specialized applications, consider Avi-tag Biotinylated constructs using E. coli biotin ligase (BirA) technology

Purification Strategy:

  • Two-step purification process: affinity chromatography followed by size exclusion

  • Use of mild detergents to maintain structural integrity of the transmembrane domains

  • Buffer optimization to prevent aggregation

Quality Control Metrics:

  • Purity assessment: >85% as determined by SDS-PAGE

  • Functional validation: Binding assays with 5-lipoxygenase

  • Structural integrity: Circular dichroism to confirm alpha-helical content

Storage Considerations:
The shelf life is affected by multiple factors including buffer ingredients, storage temperature, and the protein's inherent stability:

  • Liquid form: 6 months at -20°C/-80°C

  • Lyophilized form: 12 months at -20°C/-80°C

For experimental applications requiring membrane-embedded ALOX5AP that more closely mimics the native environment, nanodiscs have been successfully used to reconstitute the protein in lipid bilayers, allowing visualization of 5LO binding in the presence of Ca2+ ions .

  • What methodological approaches are most effective for studying the interaction between ALOX5AP, 5-lipoxygenase, and Coactosin-like protein (CLP)?

Studying the complex interactions between ALOX5AP, 5-lipoxygenase (5LO), and Coactosin-like protein (CLP) requires an integrated methodological approach:

A. Genetic Knockdown Studies:
Selective knockdown of individual components using shRNA has proven highly effective in delineating their unique contributions. For example, in Mono Mac 6 (MM6) cells:

  • CLP knockdown resulted in 50-70% reduction in leukotriene formation depending on stimuli

  • FLAP knockdown showed 75-100% reduction in product formation from endogenous substrates

  • Different knockdown combinations help distinguish overlapping functions

B. Protein Localization Analysis:

  • Subcellular fractionation: Using mild detergent (Nonidet P-40) lysis followed by Western blot analysis of nuclear and non-nuclear fractions

  • Immunocytochemistry with confocal microscopy: Visualizing translocation patterns after cell stimulation

  • Quantification metrics: 5LO/H4 ratio in nuclear fractions compared between control and knockdown cells

C. Protein-Protein Interaction Assays:

  • Coimmunoprecipitation: To detect 5LO-CLP complex formation before and after cell stimulation

  • Proximity ligation assays: Demonstrating that 5LO binding is most productive within 40 nm distance to FLAP

  • Yeast two-hybrid screening: Originally used to identify CLP as a 5LO-binding protein

  • Native PAGE and chemical cross-linking: Showing that 5LO binds CLP with 1:1 molar stoichiometry

D. Functional Activity Assessment:

  • Enzymatic activity assays using different stimuli:

    • Ionophore A23187 with/without exogenous arachidonic acid

    • PMA (phorbol myristate acetate) plus ionophore

    • Physiological stimuli: LPS priming followed by fMLP (N-formylmethionyl-leucyl-phenylalanine)

  • Product analysis: Measuring 5-HETE and LTC4 formation via HPLC or LC-MS/MS

  • Ratio analysis: LTC4/5-HETE ratios provide insights into the catalytic preferences of the complex

Research has revealed that in unstimulated cells, 5LO resides primarily in the cytosol while FLAP is constitutively present in the nuclear membrane. Upon stimulation, 5LO translocates to the nuclear membrane, forming a perinuclear ring pattern. This redistribution is significantly compromised in both CLP and FLAP knockdown cells, with 5LO staining remaining diffusely cytosolic after stimulation .

Coimmunoprecipitation experiments indicate that 5LO-CLP complex formation increases after stimulation with ionophore, and this complex forms to the same extent in FLAP knockdown cells. This suggests that the 5LO-CLP complex forms independently of FLAP, but FLAP is required for the complex to associate effectively with the nuclear membrane .

  • How do genetic variants in the ALOX5AP gene affect susceptibility to inflammatory and cardiovascular diseases?

Genetic variants in the ALOX5AP gene have been consistently associated with susceptibility to inflammatory and cardiovascular diseases, particularly stroke. The methodological approach to studying these associations typically involves:

Case-Control Study Design:
Large-scale case-control studies have proven effective in identifying ALOX5AP variants associated with disease risk. For example, a study examining 639 stroke patients and 736 matched controls from Central Europe found nominally significant associations between several ALOX5AP SNPs and stroke risk .

Key Genetic Variants:
Several single nucleotide polymorphisms (SNPs) have been identified as having significant disease associations:

  • SNP SG13S114: Part of the Icelandic at-risk haplotype, shows stronger association in males (odds ratio, 1.24; 95% CI, 1.04 to 1.55; P=0.017)

  • SNP SG13S100: Also shows stronger male association (odds ratio, 1.26; 95% CI 1.03 to 1.54; P=0.024)

  • rs10507391 and rs12429692: Selected for their minor allele frequency (MAF) > 0.05 and previous significant associations

Gender-Specific Effects:
A consistent finding across multiple studies is that ALOX5AP variants show stronger associations with disease risk in males than in females. This gender difference suggests hormonal factors may influence how ALOX5AP genetic variants affect disease pathophysiology .

Population Differences:
The frequencies of ALOX5AP single-marker alleles and haplotypes differ substantially between populations. For instance, significant differences exist between Icelandic and Central European populations, which may contribute to the observed differences in disease associations. This highlights the importance of population-specific genetic studies .

Functional Impact:
Research suggests these genetic variants may affect:

  • ALOX5AP expression levels

  • Efficiency of leukotriene biosynthesis

  • Inflammatory response intensity

  • Susceptibility to atherosclerosis, myocardial infarction, and stroke

Methodological Validation:
For genotyping, TaqMan assays have been effectively used to determine ALOX5AP variants. In some studies, plasma leukotriene B4 (LTB4) levels are analyzed to provide a functional correlation with genetic findings .

These findings highlight ALOX5AP as an important genetic risk factor for inflammatory and cardiovascular diseases, with potential implications for personalized prevention and treatment strategies.

  • What are the methodological challenges in differentiating between FLAP-dependent and FLAP-independent 5-lipoxygenase activity?

Differentiating between FLAP-dependent and FLAP-independent 5-lipoxygenase (5LO) activity presents several methodological challenges that researchers must address through careful experimental design:

Challenge 1: Source of Arachidonic Acid
Research has demonstrated that FLAP-dependent and FLAP-independent pathways can be distinguished based on substrate source:

  • Exogenous arachidonic acid (AA) can be converted by 5LO in a largely FLAP-independent manner

  • Endogenous AA utilization requires FLAP for effective conversion

Experimental Approach: To address this challenge, researchers use parallel experimental conditions:

  • Stimulation with ionophore A23187 alone (relies on endogenous AA)

  • Stimulation with ionophore A23187 plus exogenous AA

  • Comparison of product formation between FLAP knockdown and control cells under both conditions

Challenge 2: Physiological vs. Artificial Stimuli
Different stimuli can activate distinct pathways with varying dependencies on FLAP:

  • Artificial stimuli (like calcium ionophore) may bypass certain regulatory steps

  • Physiological stimuli provide more relevant but complex activation patterns

Experimental Approach: Use of multiple stimulation protocols:

  • Calcium ionophore A23187 (artificial stimulus)

  • PMA (phorbol myristate acetate) priming followed by ionophore (enhanced artificial stimulus)

  • LPS priming followed by fMLP (physiological stimulus)

Studies show that with physiological stimuli (LPS+fMLP), FLAP dependency is even more pronounced. In FLAP knockdown cells, no LTC4 was detectable after this physiological stimulus, while CLP knockdown resulted in approximately 70% decrease .

Challenge 3: Subcellular Localization Dynamics
5LO translocation patterns provide important insights into FLAP dependency but require sophisticated tracking:

Experimental Approach:

  • Subcellular fractionation: Using mild detergent lysis to separate nuclear and non-nuclear fractions

  • Immunocytochemistry: Visualizing protein localization before and after stimulation

  • Quantitative metrics: Calculating the 5LO/H4 ratio in nuclear fractions

In control cells stimulated with PMA+ionophore, 5LO shows a clear perinuclear ring pattern. This redistribution is compromised in FLAP knockdown cells, with 5LO staining remaining diffusely cytosolic. The 5LO/H4 ratio in nuclear fractions decreases to approximately 18-25% in FLAP knockdown cells compared to controls .

Challenge 4: Product Pattern Analysis
The ratio of different 5LO products can provide clues about pathway utilization:

Experimental Approach:

  • Measurement of multiple products (5-HETE, LTA4, LTC4)

  • Calculation of product ratios (e.g., LTC4/5-HETE)

  • Comparison across different genetic backgrounds and stimuli

Interestingly, when MM6 cells were stimulated with ionophore or PMA+ionophore, the LTC4/5-HETE ratio was close to 1 for both control and knockdown cells. This suggests that while the absolute amounts of products change, the relative efficiency of the two sequential reactions remains similar .

By systematically addressing these challenges, researchers can effectively distinguish between FLAP-dependent and FLAP-independent 5LO activity, providing crucial insights into leukotriene biosynthesis regulation.

  • How does ALOX5AP expression and methylation status impact prognosis in acute myeloid leukemia (AML)?

ALOX5AP expression and methylation status have emerged as significant prognostic factors in acute myeloid leukemia (AML). Comprehensive research incorporating multiple methodological approaches has revealed:

Expression Patterns:
ALOX5AP expression is significantly increased in bone marrow cells of AML patients compared with healthy donors. Studies utilizing both public datasets (TCGA, GEO databases) and independent patient cohorts have confirmed this finding:

  • ALOX5AP expression in AML patients: median 8.404 (range 3.55–17.16)

  • ALOX5AP expression in healthy controls: median 2.627 (range 1.21–9.82)

  • Statistical significance: P = 0.0017

Diagnostic Potential:
ROC curve analysis demonstrates ALOX5AP expression has strong discriminative capacity to distinguish AML from controls:

  • Area Under Curve (AUC): 0.8770

  • 95% CI: 0.7738–0.9803

  • P-value: < 0.0001

Methylation Status:
DNA methylation levels of ALOX5AP are significantly lower in AML patients compared to normal samples, as confirmed in multiple independent datasets:

  • Average β values of CpG sites in ALOX5AP gene: significantly reduced in AML patients compared to controls (P < 0.001)

  • Negative correlation between methylation levels and mRNA expression (R = -0.1152, P = 0.0103)

  • Confirmation through both the Diseasemeth database (P = 8.8e−06) and GSE63409 cohort (P = 0.01)

  • TCGA AML cohort: P = 0.006

  • GSE10358, GSE37642, GSE106291, and GSE146173: all confirmed significant association between elevated ALOX5AP mRNA levels and poor prognosis

Clinical Associations:
Patients with high ALOX5AP expression present distinct clinical characteristics:

  • More likely to be older (P = 0.002)

  • Higher white blood cell (WBC) counts (P = 0.005)

  • Less favorable karyotype (P = 0.03)

  • Lower frequency of IDH1 mutations (P < 0.05)

Gene Expression Correlations:
ALOX5AP expression level is:

  • Positively associated with proleukemic genes (PAX2, HOX family, SOX11, H19) and oncogenic microRNAs (miR125b, miR-93, miR-494, miR-193b)

  • Negatively correlated with anti-leukemia-related genes and tumor suppressor microRNAs (miR-582, miR-9 family, miR-205)

Hematopoietic Development Pattern:
ALOX5AP transcripts show a distinct pattern during normal hematopoiesis:

  • Low in hematopoietic stem cells from bone marrow (BM HSCs)

  • Sharp increase in committed progenitors (CMP and GMP)

  • Maintained at high and stable levels during myeloid maturation

These findings establish ALOX5AP as a valuable prognostic biomarker in AML, with its expression and methylation status offering insights into disease development, progression, and potential therapeutic targeting.

  • What are the current methodological approaches for developing and evaluating ALOX5AP inhibitors as anti-inflammatory agents?

Current methodological approaches for developing and evaluating ALOX5AP inhibitors involve a multidisciplinary strategy combining structural insights, functional assays, and disease models:

Structure-Based Drug Design:
The structure of FLAP provides a critical tool for inhibitor development. FLAP consists of 4 transmembrane alpha helices arranged in a trimer forming a barrel approximately 60 Å high and 36 Å wide. This structural knowledge enables:

  • Virtual screening of compound libraries targeting the FLAP binding pocket

  • Structure-activity relationship (SAR) studies to optimize lead compounds

  • Fragment-based drug design approaches

  • Molecular dynamics simulations to understand inhibitor binding dynamics

In Vitro Screening Assays:
Several complementary assays are employed to evaluate ALOX5AP inhibitor candidates:

  • Cell-free Assays:

    • Direct binding assays using purified recombinant ALOX5AP

    • Competition assays with radiolabeled ligands

  • Cellular Assays:

    • Inhibition of leukotriene production in stimulated human monocytes/neutrophils

    • Measurement of 5-HETE and LTC4 by HPLC or LC-MS/MS

    • Assessment of 5LO translocation to the nuclear membrane via immunofluorescence

    • Comparison of inhibitor effects on exogenous vs. endogenous AA conversion

  • Selectivity Profiling:

    • Counter-screening against related pathway components

    • Assessment of effects on other inflammatory mediators

Disease Model Evaluation:
Promising inhibitors advance to disease model testing:

  • Inflammatory Disease Models:

    • Respiratory disease models (asthma, COPD)

    • Cardiovascular disease models (atherosclerosis)

    • Cerebrovascular disease models (stroke, CSVD)

  • Cancer Models:

    • Acute myeloid leukemia models, where ALOX5AP is significantly overexpressed

    • Assessment of inhibitor effects on cancer cell proliferation and survival

Combination Therapy Approaches:
Research has explored combination therapies, such as Baicalin-Gardenoside (BC/GD) in cerebral small vessel disease (CSVD), which regulates the ALOX5AP-mediated 5-LOX pathway by:

  • Significantly reducing serum LTB4 levels

  • Inhibiting excessive production of inflammatory factors

  • Improving brain tissue pathological damage

  • Regulating lipid metabolism disorders and inflammation

Biomarker Development:
To facilitate clinical translation, biomarkers are being developed to:

  • Monitor target engagement (reduction in LTB4 production)

  • Identify patient populations most likely to benefit from therapy

  • Track treatment response in clinical studies

Challenges and Considerations:
Several methodological challenges remain:

  • Ensuring inhibitors can reach the nuclear membrane where FLAP is localized

  • Developing appropriate pharmacokinetic properties for chronic administration

  • Balancing complete inhibition of pro-inflammatory leukotrienes while preserving production of specialized pro-resolving mediators (lipoxins, resolvins)

  • Addressing potential compensatory mechanisms in the arachidonic acid cascade

The development of ALOX5AP inhibitors represents a promising therapeutic approach for various inflammatory conditions, with current methodologies enabling increasingly sophisticated drug discovery and evaluation processes.

Human Genetic Studies

  • What are the most significant ALOX5AP genetic variants associated with stroke risk, and how do they vary across populations?

Research into ALOX5AP genetic variants has revealed significant associations with stroke risk that vary considerably across different populations. Methodological approaches to identifying and validating these associations include:

Key Genetic Variants:
Several ALOX5AP single nucleotide polymorphisms (SNPs) have been identified as significant risk factors for stroke:

  • HapA Haplotype Components:

    • SG13S114: Part of the Icelandic at-risk haplotype, shows consistent association across studies

    • SG13S89, SG13S25, and SG13S32: Other components of the HapA haplotype

  • Additional Significant SNPs:

    • SG13S100: Shows strong association in Central European populations (odds ratio, 1.26; 95% CI 1.03 to 1.54; P=0.024)

    • rs10507391 and rs12429692: Commonly studied variants with MAF > 0.05

Population Differences:
A striking finding across studies is the significant variation in allele frequencies and haplotype structures among different populations:

  • Icelandic vs. Central European Populations:

    • The frequencies of single-marker alleles and haplotypes differ substantially

    • Linkage disequilibrium (LD) patterns show population-specific structures

    • These differences may contribute to the observed variations in disease associations

  • Han Chinese of Eastern China:

    • Studies examining rs10507391 and rs12429692 in Han Chinese populations (690 ischemic stroke cases and 767 controls) show population-specific patterns

    • Genotyping using TaqMan assays reveals distinct distribution compared to European cohorts

Gender-Specific Associations:
A consistent finding across multiple studies is the stronger association of ALOX5AP variants with stroke risk in males compared to females:

  • SG13S114: Odds ratio 1.24 (95% CI, 1.04 to 1.55; P=0.017) in males

  • SG13S100: Odds ratio 1.26 (95% CI 1.03 to 1.54; P=0.024) in males

  • These gender differences suggest hormonal factors may influence how ALOX5AP genetic variants affect stroke pathophysiology

Stroke Subtype Analysis:
When patients are subtyped according to the Trial of Org 10172 in Acute Stroke Treatment (TOAST) criteria, certain patterns emerge:

  • Some variants show stronger associations with atherothrombotic stroke

  • Others may have stronger links to cardioembolic or small vessel disease subtypes

  • This subtype analysis provides insights into the mechanisms by which ALOX5AP variants contribute to stroke risk

Functional Correlations:
To establish the functional significance of these genetic associations, some studies have measured plasma leukotriene B4 (LTB4) levels:

  • Elevated LTB4 levels in carriers of risk variants suggest a mechanistic link through enhanced inflammatory responses

  • This provides a biological basis for the observed genetic associations

The identification of these population-specific genetic risk factors has important implications for personalized medicine approaches, suggesting that stroke risk stratification and prevention strategies may need to be tailored to specific genetic backgrounds.

  • What experimental systems are most effective for studying the role of ALOX5AP in cerebral small vessel disease (CSVD)?

Studying the role of ALOX5AP in cerebral small vessel disease (CSVD) requires a multi-faceted approach integrating both clinical research and animal models. Based on recent studies, the following experimental systems have proven most effective:

Clinical Cohort Analysis:
Comprehensive clinical studies provide valuable insights into ALOX5AP's role in human CSVD:

  • Plasma Proteomics:

    • Differential proteomic analysis of CSVD patients versus controls

    • Identification of ALOX5AP as a dual-functional hub molecule for both inflammation and lipid metabolism

    • Quantification of differentially expressed proteins (45 identified in recent studies)

  • Inflammatory Biomarker Profiling:

    • Measurement of serum leukotriene B4 (LTB4) levels as a direct product of the 5-LOX pathway

    • Assessment of pro-inflammatory cascade factors: interleukin-6 (IL-6), tumor necrosis factor-α (TNF-α), homocysteine (Hcy), and high-sensitivity C-reactive protein (hs-CRP)

    • Correlation of these markers with disease severity and progression

  • Lipid Metabolism Analysis:

    • Evaluation of dyslipidemia parameters, particularly TC/HDL-C ratio

    • Association studies between lipid profiles and ALOX5AP expression/activity

Animal Models:
Rat models of CSVD have been successfully employed to study ALOX5AP mechanisms and interventions:

  • Model Development:

    • Various induction methods including hypertension-based models, hyperhomocysteinemia models, and CADASIL transgenic models

    • Validation through histopathological and functional assessments

  • Therapeutic Intervention Testing:

    • Baicalin-Gardenoside (BC/GD) combination therapy (60 mg/kg) has shown efficacy in these models

    • Evaluation of treatment effects on neuronal damage, lipid metabolism, and inflammatory markers

    • Assessment of improvement in brain tissue pathology

  • Molecular Mechanism Studies:

    • Investigation of the ALOX5AP-mediated 5-LOX pathway

    • Measurement of serum LTB4 reduction following intervention

    • Analysis of inflammatory factor production inhibition

    • Evaluation of effects on lipid metabolism disorders

Cellular Models:
Cell-based systems provide mechanistic insights at the molecular level:

  • Primary Cell Cultures:

    • Human brain microvascular endothelial cells

    • Pericytes and astrocytes to study neurovascular unit interactions

    • Response to inflammatory stimuli and hypoxic conditions

  • Genetic Manipulation:

    • ALOX5AP knockdown or overexpression in relevant cell types

    • Assessment of effects on inflammatory responses and cell viability

    • Examination of 5LO nuclear translocation patterns

Integrated Approaches:
The most powerful insights come from integrating multiple experimental systems:

  • Translational Research Pipeline:

    • Initial identification of ALOX5AP involvement through clinical proteomics

    • Validation in animal models to establish causality

    • Mechanistic studies in cellular systems

    • Testing of therapeutic interventions across platforms

  • Combined Readouts:

    • Functional neuroimaging (MRI findings in patients and animal models)

    • Histopathological analysis of vascular damage

    • Biochemical assessment of inflammatory markers

    • Behavioral and cognitive evaluations

This integrated approach has revealed that intervention targeting the ALOX5AP-mediated pathway can effectively alleviate neuronal damage, modulate lipid metabolism abnormalities, and reduce inflammatory factor levels, suggesting promising therapeutic avenues for CSVD management.

  • How do CLP and FLAP cooperate or compete in regulating 5-lipoxygenase activity and what methodologies best reveal these interactions?

The complex interplay between Coactosin-like protein (CLP) and 5-lipoxygenase-activating protein (FLAP) in regulating 5-lipoxygenase (5LO) activity has been elucidated through sophisticated methodological approaches revealing both cooperative and potentially competitive interactions:

Complementary Roles Revealed Through Knockdown Studies:
Selective knockdown experiments in Mono Mac 6 (MM6) cells have demonstrated distinct yet complementary roles:

  • CLP's Role (Soluble Protein):

    • Enhances 5LO activity across all stimulation conditions

    • Increases both 5-HETE and LTC4 formation

    • Not absolutely crucial, as some 5LO activity remains in CLP knockdown cells (30-50% of control activity)

    • CLP knockdown results in 53-70% reduction in leukotriene formation depending on stimuli

  • FLAP's Role (Membrane Protein):

    • Essential for utilizing endogenous arachidonic acid (AA)

    • Minor effects when exogenous AA is provided

    • Critical for 5LO association with the nuclear membrane

    • FLAP knockdown results in 75-100% reduction in product formation from endogenous substrates

Translocation Dynamics:
Subcellular fractionation and immunocytochemistry have revealed how these proteins coordinate 5LO positioning:

  • Unstimulated Cells:

    • 5LO resides in the cytosol

    • CLP is distributed throughout the cell

    • FLAP is constitutively present in the nuclear membrane

    • No detectable association of 5LO with nuclear fraction

  • After Stimulation:

    • Control cells: 5LO appears in the nuclear fraction, forming a clear perinuclear ring pattern

    • CLP knockdown cells: 5LO association with nuclear fraction decreases to 24-32% of control

    • FLAP knockdown cells: 5LO association with nuclear fraction decreases to 18-25% of control

    • Both knockdowns result in diffuse cytosolic 5LO staining rather than perinuclear localization

Complex Formation Studies:
Coimmunoprecipitation experiments provide crucial insights into the sequence of interactions:

  • 5LO-CLP Complex:

    • Formation increases after stimulation with ionophore

    • Forms to the same extent in FLAP knockdown cells

    • Suggests the 5LO-CLP complex forms independently of FLAP

  • CLP Nuclear Association:

    • Almost absent after 5LO knockdown

    • Clearly reduced in FLAP knockdown cells

    • Indicates CLP nuclear association depends on both 5LO and FLAP

Proposed Interaction Model:
These findings suggest a sequential model where:

  • 5LO-CLP complex forms in the cytosol upon stimulation

  • This complex translocates to the nuclear membrane

  • FLAP stabilizes the association of this complex with the perinuclear membrane

  • The complete 5LO-CLP-FLAP assembly enables efficient leukotriene biosynthesis

Methodological Approaches for Studying These Interactions:
The most effective methods include:

  • Genetic Manipulation:

    • shRNA knockdown of individual components

    • Comparison of single vs. double knockdowns

    • Rescue experiments with mutant constructs

  • Protein Localization Techniques:

    • Subcellular fractionation with Western blot analysis

    • Immunocytochemistry with confocal microscopy

    • Quantitative image analysis of translocation patterns

  • Protein Interaction Assays:

    • Coimmunoprecipitation under various stimulation conditions

    • Proximity ligation assays to detect interactions within 40nm

    • FRET or BRET to detect real-time interaction dynamics

  • Functional Activity Assessment:

    • Parallel stimulation protocols (ionophore, PMA+ionophore, LPS+fMLP)

    • Analysis of multiple 5LO products (5-HETE, LTC4)

    • Comparison of activity with endogenous vs. exogenous AA

These methodological approaches have revealed that while CLP and FLAP serve distinct functions in the 5LO activation process, they ultimately cooperate to facilitate efficient leukotriene biosynthesis, with neither protein fully compensating for the absence of the other.

  • What methodological advances have improved our understanding of ALOX5AP's role in the temporal and spatial regulation of leukotriene biosynthesis?

Recent methodological advances have significantly enhanced our understanding of ALOX5AP's role in the temporal and spatial regulation of leukotriene biosynthesis. These innovative approaches have revealed intricate details of protein interactions, membrane dynamics, and enzymatic activities:

Advanced Imaging Techniques:

  • Proximity Ligation Assays:

    • Demonstrated that 5LO binding to FLAP is most productive in an initial stage and within 40 nm distance

    • Revealed that at later stages, leukotriene production may slow due to conformational changes or tighter binding

    • Provided spatial resolution of protein interactions below the diffraction limit

  • High-Resolution Confocal Microscopy:

    • Visualization of the perinuclear ring pattern of 5LO after stimulation

    • Detailed tracking of 5LO translocation from cytosol to nuclear membrane

    • Comparison of translocation patterns in control, CLP-knockdown, and FLAP-knockdown cells

  • Live-Cell Imaging:

    • Real-time monitoring of protein movements during stimulation

    • Temporal resolution of the 5LO translocation process

    • Correlation with leukotriene production kinetics

Membrane Biology Approaches:

  • Nanodiscs Technology:

    • Direct visualization of 5LO binding to nanodiscs containing FLAP

    • Confirmation that Ca²⁺ ions are necessary for the translocation

    • Reconstitution of the membrane environment to study protein interactions

  • Lipid Analysis Techniques:

    • Detailed profiling of membrane lipid composition

    • Assessment of arachidonic acid distribution and mobilization

    • Understanding how FLAP facilitates arachidonic acid transfer to 5LO

Molecular and Structural Studies:

  • Mutational Analysis:

    • Identification of a triple lysine motif in 5LO that functions as a conformational switch

    • Discovery of the "FY-cork" that keeps 5LO protected until correct 5LO-FLAP interaction

    • Elucidation of how these elements regulate efficient leukotriene synthesis

  • Structural Biology Approaches:

    • Characterization of FLAP's 4 transmembrane alpha helices arranged in a trimer

    • Determination that the barrel structure is approximately 60 Å high and 36 Å wide

    • Understanding how this structure facilitates interaction with 5LO and arachidonic acid

Temporal Regulation Insights:

  • Time-Resolved Activity Assays:

    • Differentiating between early and late phases of leukotriene biosynthesis

    • Correlation between 5LO-FLAP proximity and enzymatic efficiency

    • Evidence that the productive complex may change over time

  • Kinetic Analysis:

    • Determination that epoxidation of 5(S)-HpETE has a rate of substrate capture significantly lower than AA hydroperoxidation

    • Hyperbolic kinetic parameters for ATP activation indicating similar activation for AA and 5(S)-HpETE

    • Understanding how these kinetic parameters affect the temporal regulation of leukotriene synthesis

Integrated Cellular Systems:

  • Physiological Stimulation Protocols:

    • Comparison between artificial stimuli (ionophore) and physiological stimuli (LPS+fMLP)

    • Assessment of how different activation pathways affect FLAP dependency

    • Understanding the temporal sequence of events under conditions mimicking inflammation

  • Cell Type-Specific Analysis:

    • Comparison of mechanisms across different cell types (monocytes, macrophages, neutrophils)

    • Understanding tissue-specific regulation of leukotriene biosynthesis

    • Correlation with disease-specific inflammatory responses

These methodological advances have collectively revealed that ALOX5AP/FLAP plays multiple critical roles in leukotriene biosynthesis: (1) facilitating 5LO translocation to the nuclear membrane, (2) providing endogenous arachidonic acid to 5LO, (3) stabilizing the 5LO-CLP complex at the membrane, and (4) enhancing the catalytic efficiency of 5LO. The temporal and spatial coordination of these functions ensures precise regulation of inflammatory mediator production.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.