Recombinant Human Armadillo repeat-containing X-linked protein 4 (ARMCX4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ARMCX4; Armadillo repeat-containing X-linked protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-360
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
ARMCX4
Target Protein Sequence
MSAAGLKITGSKETKRRLLLISIDWSRDLMNLCIYFRVYCQEKQEERRELPRIITGPPPE AAVVAFEWLKTSTLTGLHPQLPLSLPQPECALPYLVRAFSRGDYMGRIQEVGWVTAGLVI WAGTCYYIYKFTKGRAQSVRTLARNGSTVKMETVVGVQSQTLAINEAEIKTKPQVEIGAE TGARSGPRAEVETKATAIAIHRANSQAKAMVGAEPETQSESKVVAGTLVMTEAVTLTEVK AKAREVAMKEAVTQTDAEAGKIVKKEAVTQTKAKAWALVAKTEAKREAMTQTKAETHILA EKETEINRVMVTQSETLAVPREVAKMGATNKTGIVDETKTRALEETVLIPRAFPSKNASC
Uniprot No.

Target Background

Database Links

HGNC: 28615

STRING: 9606.ENSP00000404304

UniGene: Hs.729062

Protein Families
Eutherian X-chromosome-specific Armcx family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the structural composition of ARMCX4?

ARMCX4 belongs to the armadillo repeat-containing protein subfamily, which features a characteristic domain consisting of tandem repeats approximately 42 amino acids in length. This domain creates a substantial platform for protein-protein interactions. ARMCX4, like other members of the ARMCX cluster, contains two mitochondrial outer membrane (MOM)-targeting sequences in its N-terminus that facilitate its localization to the outer mitochondrial membrane . The protein's structure includes armadillo repeat domains that are highly conserved across species, particularly within mammals .

What are the known biological functions of ARMCX4?

ARMCX4 has been implicated in several important biological processes based on current research. One of its primary functions appears to be promoting the differentiation of spermatogonial stem cells (SSCs) . This role in male reproductive biology is significant, as mutations in ARMCX4 have been linked to male infertility . The high conservation of armadillo repeat domains across mammalian species supports the critical nature of this function.

At the molecular level, ARMCX4 interacts with DPAGT1, an enzyme that catalyzes N-glycosylation as a post-translational modification . This interaction suggests that ARMCX4 may influence protein functionality through glycosylation pathways. Through this DPAGT1 interaction, ARMCX4 is thought to potentially inhibit conditions such as congenital myasthenic syndrome (CMS), GD (likely Gaucher's disease), male infertility, and neonatal maxillofacial deformities .

The protein's localization to the mitochondrial outer membrane, facilitated by its MOM-targeting sequences, indicates potential roles in mitochondrial function regulation, which could have broad implications for cellular energy metabolism and homeostasis .

How has ARMCX4 evolved across different species?

ARMCX4 demonstrates a fascinating evolutionary pattern that provides insights into its functional importance. The protein is highly conserved in primates, with 98% identity between human and gorilla ARMCX4 proteins . This high degree of conservation suggests strong evolutionary pressure to maintain the protein's structure and function in primates.

Why are the armadillo repeat domains of ARMCX4 more conserved than other regions?

Armadillo repeat domains generally serve as protein-protein interaction platforms, creating binding surfaces for molecular partners. The high conservation of these domains in ARMCX4 strongly suggests that specific protein-protein interactions mediated by these domains are fundamental to ARMCX4 function across mammalian species. These interactions likely involve pathways critical for basic cellular processes that cannot tolerate significant sequence variation.

In contrast, the lower conservation in non-armadillo repeat regions suggests these areas may be involved in species-specific functions or fine-tuning of activities that can accommodate more sequence variation. Alternatively, these regions might serve as linkers or spacers whose exact sequence is less critical than their general properties such as length, charge, or flexibility.

What are the optimal methods for expressing recombinant ARMCX4 protein?

When expressing recombinant ARMCX4 for research purposes, several methodological considerations are critical for obtaining functional protein. Based on the characteristics of ARMCX4 and related armadillo repeat-containing proteins, the following approach is recommended:

For construct design, including the complete armadillo repeat domains is essential given their high conservation and functional importance. If studying mitochondrial localization, the N-terminal mitochondrial outer membrane (MOM)-targeting sequences must be preserved. Depending on purification strategy, epitope tags should be positioned to avoid interfering with domain function – typically C-terminal tagging is preferable for ARMCX4 to prevent disruption of the N-terminal targeting sequences .

Expression conditions require careful optimization: for bacterial systems, lower induction temperatures (16-18°C) typically improve folding of armadillo repeat proteins. For mammalian systems, transient transfection followed by expression for 48-72 hours generally yields functional protein. Purification strategies should employ gentle conditions to preserve protein folding, often using affinity chromatography followed by size exclusion to ensure homogeneity .

Validation of recombinant ARMCX4 functionality should include assessment of proper folding (circular dichroism spectroscopy), interaction with known binding partners (co-immunoprecipitation with DPAGT1), and subcellular localization if relevant to the study .

What techniques are most effective for studying ARMCX4 protein-protein interactions?

Understanding ARMCX4's protein-protein interactions is crucial for elucidating its functions, particularly given that armadillo repeat domains typically serve as protein-protein interaction platforms. Several complementary techniques have proven effective for studying such interactions:

Co-immunoprecipitation (Co-IP) represents a foundational approach for validating physiologically relevant interactions. For ARMCX4, this can be performed using either antibodies against the endogenous protein or epitope-tagged recombinant versions. When investigating the documented interaction between ARMCX4 and DPAGT1, conducting reciprocal Co-IPs (pulling down with anti-ARMCX4 and detecting DPAGT1, then vice versa) strengthens confidence in results . Cell fractionation prior to Co-IP can help confirm interactions occurring at the mitochondrial membrane.

Proximity labeling methods such as BioID or APEX2 are particularly valuable for identifying the interactome of membrane-associated proteins like ARMCX4. These approaches involve fusing ARMCX4 to a biotin ligase or peroxidase that biotinylates nearby proteins, which can then be purified and identified by mass spectrometry. This approach is especially useful for detecting transient or weak interactions that might be lost during traditional Co-IP procedures .

For direct binding studies, in vitro techniques including surface plasmon resonance (SPR), isothermal titration calorimetry (ITC), or microscale thermophoresis (MST) can determine binding affinities and kinetics between purified ARMCX4 and candidate interacting proteins. These approaches are particularly valuable for mapping specific interaction domains and characterizing how mutations impact binding properties .

Fluorescence-based interaction assays in living cells, such as Förster resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC), can confirm interactions in the cellular context while providing spatial information about where these interactions occur—particularly important given ARMCX4's mitochondrial localization .

How does ARMCX4 contribute to male fertility?

At the molecular level, ARMCX4's interaction with DPAGT1, which catalyzes N-glycosylation as a post-translational modification, appears central to its role in fertility . N-glycosylation affects protein folding, stability, and function, suggesting that ARMCX4 may regulate the glycosylation status of proteins involved in spermatogenesis. This interaction provides a mechanistic link between ARMCX4 and male fertility, as proper protein glycosylation is essential for normal cellular differentiation and function.

The critical nature of ARMCX4 in male reproductive health is underscored by findings that mutations in ARMCX4 can cause male infertility . These mutations likely disrupt either the protein's ability to promote SSC differentiation or its interaction with DPAGT1, consequently affecting the glycosylation of proteins necessary for proper spermatogenesis. The study of specific mutations and their effects on protein function could provide valuable insights into the precise mechanisms by which ARMCX4 influences fertility.

Research approaches to further elucidate ARMCX4's role in fertility would benefit from conditional knockout models specifically targeting ARMCX4 expression in the male reproductive system, along with detailed analyses of spermatogenesis stages and glycosylation patterns of relevant proteins in both normal and ARMCX4-deficient conditions .

What is known about ARMCX4's role in pathological conditions?

Based on its molecular interactions and evolutionary conservation, ARMCX4 has been implicated in several pathological conditions beyond male infertility. Through its interaction with DPAGT1, ARMCX4 may play a role in inhibiting conditions such as congenital myasthenic syndrome (CMS), Gaucher's disease (GD), and neonatal maxillofacial deformities .

Congenital myasthenic syndrome (CMS) involves impaired neuromuscular transmission, and mutations in DPAGT1 are known to cause a specific form of this disorder. Given ARMCX4's interaction with DPAGT1, it may influence the glycosylation of proteins critical for neuromuscular junction formation and function. Disruption of this interaction could potentially contribute to CMS pathophysiology through abnormal glycosylation of key synaptic proteins .

In the context of neonatal maxillofacial deformities, there are interesting parallels with findings related to ARMC4 (another member of the armadillo repeat-containing family). Partial deletion of ARMC4 has been linked to maxillofacial deformities in newborns, characterized by deregulation of embryonic development or cell proliferation . Given the functional similarities within the ARMC family and ARMCX4's interaction with DPAGT1, ARMCX4 might influence craniofacial development through glycosylation-dependent mechanisms.

Research into ARMCX4's pathological roles would benefit from detailed expression analyses in affected tissues, genetic association studies in patient cohorts, and functional studies using cellular and animal models of these conditions. Particularly valuable would be investigations into how specific disease-associated mutations affect ARMCX4's interaction with DPAGT1 and subsequent downstream glycosylation events .

How might ARMCX4's mitochondrial localization influence its functions?

ARMCX4 contains two mitochondrial outer membrane (MOM)-targeting sequences in its N-terminus that facilitate its localization to the outer mitochondrial membrane . This subcellular localization is a distinctive feature of the ARMCX cluster proteins and likely has significant functional implications that warrant deeper investigation.

The mitochondrial localization of ARMCX4 suggests potential roles in regulating mitochondrial functions, which could include influence over energy metabolism, calcium signaling, apoptosis, or mitochondrial dynamics. Other members of the ARMC subfamily with mitochondrial localization, such as ARMCX3, participate in the regulation of mitochondrial trafficking and dynamics through interactions with the KIF5/Miro/Trak2 complex . ARMCX4 may have similar roles or could regulate distinct mitochondrial processes through its armadillo repeat domains.

The ARMCX4-DPAGT1 interaction takes on added significance when considered in the context of mitochondrial localization. DPAGT1 catalyzes the first step in N-linked protein glycosylation, a process typically associated with the endoplasmic reticulum . The interaction between a mitochondrial protein (ARMCX4) and an enzyme involved in ER-based glycosylation suggests potential roles in inter-organelle communication or non-canonical glycosylation pathways that could be pivotal for cellular homeostasis.

Research methodologies to explore these questions should include high-resolution imaging techniques such as super-resolution microscopy to precisely map ARMCX4's localization on the mitochondrial membrane, proximity labeling approaches to identify mitochondria-specific interaction partners, and functional studies examining how ARMCX4 depletion or overexpression affects various mitochondrial parameters (membrane potential, respiratory capacity, morphology, etc.) .

What are the implications of ARMCX4's evolutionary conservation pattern for functional studies?

The evolutionary conservation pattern of ARMCX4—high conservation in primates, moderate conservation in other mammals, and absence in non-mammalian vertebrates—has significant implications for experimental design and interpretation in functional studies .

Conversely, the lower conservation in non-armadillo repeat regions suggests these areas may mediate species-specific functions or regulatory mechanisms. Studies focusing on these regions should include appropriate controls and validation steps when extrapolating from model organisms to humans. The divergence in these regions might also explain species-specific phenotypes or responses to experimental manipulations targeting ARMCX4.

The absence of ARMCX4 in non-mammalian vertebrates like zebrafish has important implications for model organism selection. While zebrafish are valuable models for many developmental and disease processes, they would be inappropriate for studying ARMCX4-specific functions. This evolutionary constraint necessitates the use of mammalian models for comprehensive functional studies of ARMCX4.

For translational research, the remarkably high conservation between human and other primate ARMCX4 (98% identity with gorilla) suggests that non-human primate models would provide the most faithful recapitulation of human ARMCX4 biology, though ethical and practical considerations often limit such studies. This conservation pattern should guide researchers in selecting appropriate model systems and interpreting results across species barriers.

What are the challenges in developing specific antibodies against ARMCX4?

Developing highly specific antibodies against ARMCX4 presents several technical challenges that researchers should consider when planning experimental approaches. Understanding these challenges and implementing appropriate strategies is essential for generating reliable research tools.

The high sequence similarity between ARMCX family members, particularly in the conserved armadillo repeat domains, creates potential cross-reactivity issues . ARMCX1, ARMCX2, and ARMCX4 share similar domain structures and sequence features, which increases the risk of antibody cross-reactivity. To address this challenge, antibody development should target unique epitopes in the less conserved regions of ARMCX4, preferably outside the armadillo repeat domains. Bioinformatic analysis to identify ARMCX4-specific sequences is a crucial first step.

The mitochondrial localization of ARMCX4 can complicate antibody accessibility in certain applications . Fixation and permeabilization protocols for immunofluorescence or flow cytometry must be optimized to ensure antibody access to mitochondrial membrane proteins while preserving epitope structure. Additionally, the membrane association may affect epitope exposure, requiring consideration of native protein topology when selecting target regions for antibody development.

For validation, rigorous specificity testing should include: (1) parallel testing in ARMCX4 knockout/knockdown cells alongside wild-type cells; (2) testing against recombinant proteins of all ARMCX family members to assess cross-reactivity; (3) peptide competition assays; and (4) correlation between protein and mRNA expression patterns across tissues. Additionally, using multiple antibodies targeting different epitopes provides stronger validation of experimental findings.

When commercial antibodies are used, researchers should independently validate specificity rather than relying solely on manufacturer claims. This is particularly important for understudied proteins like ARMCX4, where comprehensive validation data may be limited .

How can CRISPR-Cas9 technology be optimized for studying ARMCX4 function?

CRISPR-Cas9 technology offers powerful approaches for investigating ARMCX4 function through genome editing, but requires careful optimization for this specific target. The following methodological considerations should guide experimental design:

For knockout studies, guide RNA (gRNA) design should target early exons that are present in all known ARMCX4 transcript variants to ensure complete functional disruption. The high GC content often found in first exons of genes can present challenges for efficient gRNA activity, so computational tools that optimize gRNA efficiency and specificity are essential. Additionally, researchers should avoid targeting regions with significant homology to other ARMCX family members to prevent off-target effects .

When creating cell line models, verification of CRISPR-mediated modifications should include both DNA sequencing and protein-level validation. Western blotting with validated antibodies can confirm protein loss in knockout lines, while proper subcellular localization of tagged proteins should be verified in knock-in lines. For ARMCX4, confirming appropriate mitochondrial localization of tagged proteins is particularly important .

For analyzing complex phenotypes, inducible CRISPR systems offer advantages by allowing temporal control of ARMCX4 disruption, which can help distinguish between developmental versus acute roles of the protein. This approach is particularly valuable when studying ARMCX4's role in processes like spermatogonial stem cell differentiation, where developmental timing is critical .

What emerging technologies could advance understanding of ARMCX4 functions?

Several cutting-edge technologies hold promise for elucidating ARMCX4's functions and molecular mechanisms. Integration of these approaches could significantly accelerate research progress in this field.

Single-cell multi-omics approaches combining transcriptomics, proteomics, and metabolomics at the single-cell level can provide unprecedented insights into ARMCX4's cell type-specific functions. This is particularly valuable for understanding ARMCX4's role in heterogeneous tissues and differentiation processes such as spermatogenesis . By correlating ARMCX4 expression with global cellular states, researchers can identify cell populations where ARMCX4 plays critical roles and characterize the molecular networks it influences.

Cryo-electron microscopy (cryo-EM) and integrative structural biology approaches could reveal the three-dimensional structure of ARMCX4, particularly in complex with interaction partners like DPAGT1 . Understanding the structural basis of these interactions would provide mechanistic insights and potentially guide the development of specific modulators for research or therapeutic purposes. The armadillo repeat domains, with their high evolutionary conservation, would be of particular interest for structural studies.

Mitochondrial-specific proximity labeling techniques like mito-APEX or split-TurboID adapted for the mitochondrial outer membrane could comprehensively map ARMCX4's protein interaction network specifically within its mitochondrial context . This approach would help distinguish ARMCX4's mitochondrial functions from potential roles in other cellular compartments.

Organoid technologies could provide physiologically relevant models for studying ARMCX4 in complex processes like spermatogenesis or developmental contexts. Testicular organoids, in particular, could offer systems for investigating ARMCX4's role in spermatogonial stem cell differentiation under controlled conditions that better recapitulate the in vivo environment than traditional cell culture .

How might understanding ARMCX4 contribute to therapeutic developments?

The emerging understanding of ARMCX4's biological functions and disease associations suggests several potential therapeutic applications that warrant further investigation.

For male infertility associated with ARMCX4 mutations, gene therapy approaches could potentially restore fertility by delivering functional ARMCX4 to spermatogonial stem cells . The relatively small size of the ARMCX4 gene makes it amenable to delivery via adeno-associated virus (AAV) vectors. Before clinical translation, such approaches would require extensive preclinical validation in appropriate animal models to assess efficacy and safety.

Based on ARMCX4's interaction with DPAGT1 and its potential role in glycosylation pathways , therapeutic strategies targeting this interaction might be developed for conditions like congenital myasthenic syndrome or neonatal maxillofacial deformities. Small molecules or peptides that either enhance or inhibit the ARMCX4-DPAGT1 interaction could modulate glycosylation processes in a targeted manner.

ARMCX4's mitochondrial localization suggests potential roles in mitochondrial function and dynamics . If future research establishes connections between ARMCX4 and mitochondrial diseases or conditions with mitochondrial dysfunction (such as neurodegenerative disorders), targeting ARMCX4 or its interactions could represent a novel therapeutic approach. This could involve either enhancing beneficial ARMCX4 functions or inhibiting detrimental interactions.

Development of these therapeutic approaches requires significantly more research to fully characterize ARMCX4's normal functions and pathological roles. Priority areas include: (1) comprehensive phenotyping of ARMCX4 knockout models; (2) detailed characterization of disease-associated ARMCX4 mutations; (3) identification of the complete set of ARMCX4 interaction partners; and (4) elucidation of the regulatory mechanisms controlling ARMCX4 expression and activity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.