Recombinant Human astrovirus-5 Non-structural polyprotein 1AB (ORF1)

Shipped with Ice Packs
In Stock

Description

Genetic Organization of Astrovirus Genome

The astrovirus genome exhibits a distinctive organization that directly influences the structure and function of the non-structural polyprotein 1AB. The genome includes a 5′ untranslated region (UTR), followed by three open reading frames (ORF1a, ORF1b, and ORF2), a 3′ UTR, and a poly-A tail . A critical feature is the frameshift structure positioned between ORF1a and ORF1b, which enables the translation of the complete polyprotein 1AB through a -1 ribosomal frameshift mechanism .

This frameshift is typically induced by a heptameric 'slippery sequence' (AAAAAAAC) located near the end of ORF1a, followed by a stem-loop structure . This mechanism allows ribosomes to shift reading frames and continue translation into ORF1b, producing the complete non-structural polyprotein 1AB rather than terminating at the end of ORF1a . This genomic organization is fundamental to the production of essential viral enzymes including the RNA-dependent RNA polymerase encoded by ORF1b.

Functional Domains and Protein Architecture

The non-structural polyprotein 1AB contains multiple functional domains that contribute to its central role in viral replication. ORF1a encodes a serine-like protease domain essential for processing the viral polyprotein into individual functional components . This protease domain contains a catalytic triad (Histidine, Aspartate, Serine) conserved across the astrovirus family .

The ORF1b region encodes an RNA-dependent RNA polymerase (RNAP) critical for viral genome replication . This enzyme synthesizes complementary RNA strands using the viral genome as a template, enabling viral reproduction within host cells. The RNAP domain represents one of the most highly conserved regions across astrovirus species, reflecting its essential function in viral replication .

Pfam analysis of astrovirus ORF1a reveals regions with homology to peptidase domains, confirming its proteolytic function . Additionally, the non-structural polyprotein undergoes post-translational processing to produce multiple functional proteins, including the serine protease p27, which participates in further polyprotein processing .

Expression Systems and Production Strategies

The production of Recombinant Human astrovirus-5 Non-structural polyprotein 1AB (ORF1) typically employs bacterial expression systems, with Escherichia coli being the predominant host . This approach offers advantages including rapid growth rates, high protein yields, and established protocols for genetic manipulation and protein purification.

The production process begins with the cloning of the target gene sequence into an expression vector containing appropriate regulatory elements and the histidine tag sequence. Following transformation into competent E. coli cells, protein expression is induced under controlled conditions optimized for yield and solubility. Alternative expression systems, including yeast, baculovirus-infected insect cells, or mammalian cell culture systems, may also be employed depending on specific requirements for protein structure or post-translational modifications .

Purification and Quality Control Procedures

The recombinant protein, expressed with an N-terminal histidine tag, is typically purified using affinity chromatography techniques . The histidine tag exhibits high affinity for metal ions such as nickel, allowing for selective binding of the tagged protein to metal-charged resins. This enables efficient separation of the target protein from cellular components and contaminants.

Quality control procedures typically include sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) to assess protein purity, which should exceed 90% for research-grade preparations . Additional analytical techniques may include western blotting, mass spectrometry, or functional assays to verify protein identity and activity.

Enzymatic Activities and Catalytic Mechanisms

The recombinant Human astrovirus-5 Non-structural polyprotein 1AB (ORF1) encompasses several enzymatic activities crucial for viral replication. The serine protease domain functions in the processing of viral polyproteins, an essential step in generating the individual functional viral proteins required for replication. This proteolytic activity depends on the catalytic triad (Histidine, Aspartate, Serine) that is highly conserved among astroviruses .

The RNA-dependent RNA polymerase domain catalyzes the synthesis of complementary RNA strands using the viral RNA as a template, enabling genome replication. The substrate binding residues in astroviruses vary across species, with human astroviruses typically containing RTQ residues, while other astroviruses such as Ovine astrovirus contain ATR residues . Interestingly, analysis suggests that Human astrovirus-5 may share greater similarity with Ovine astrovirus in its substrate binding residues than with other human astrovirus serotypes.

Research Applications and Experimental Utility

Recombinant Human astrovirus-5 Non-structural polyprotein 1AB (ORF1) serves as a valuable research tool for multiple applications in virology, structural biology, and drug discovery. In basic research, it enables detailed investigations of protein structure, enzymatic mechanisms, and interactions with other viral or host components. Structural studies using techniques such as X-ray crystallography or cryo-electron microscopy can reveal the three-dimensional organization of the protein, providing insights into its function and potential vulnerabilities.

In diagnostic development, the recombinant protein can serve as a positive control for assays detecting viral proteins or as an antigen for generating specific antibodies. These antibodies can then be employed in immunoassays to detect viral infection or monitor immune responses.

The protein also has significant potential in drug discovery pipelines, serving as a target for screening compounds that inhibit its essential enzymatic activities. Identifying inhibitors of the protease or polymerase functions could lead to the development of novel therapeutics against astrovirus infections, addressing an unmet medical need particularly in pediatric and immunocompromised populations.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order, and we will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ORF1; Non-structural polyprotein 1AB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
914-1416
Protein Length
Full Length of Mature Protein
Species
Human astrovirus-5 (HAstV-5)
Target Names
ORF1
Target Protein Sequence
GAQNYHSLDAWKSLLEPPRERRCVPANFPLLGHLPIDRPIFDDKKPRDDLLGLLPEPTWH AFEEYGPTTWGPQAFIKSFDKFFYAEPIDFFSEYPQLCAFADWATYREFRYLEDTRVIHI TATEKNTDSTPAYPKMNYFDTEEKYLESYGWAPYIREFTRVFKGDKPEVLWYLFLKKEII KEEKIRNSDIRQIVCADPIYTRIGACLEAHQNALMKQHTETSVGQCGWSPMEGGFKKTMQ RLVNKGNKYFIEFDWTRYDGTIPPSLFRHIKEIRWNFINKDQREKYRHVHEWYVDNLLNR HVLLPSGEVTLQTRGNPSGQFSTTMDNNMINFWLQAFEFAYFNGPNKDLWKTYDTVVYGD DRLSTTPSVPENYEERVIDMYRDIFGMWVKPGKVICRESIVGLSFCGFTVNADLEPVPTS PEKLMASLLKPYKILPDLESLHGKLLCYQLLAAFMAEDHPFKVYVEHCLSRTAKQLRDSG LPARLTEEQLHRIWRGGPKKCDG
Uniprot No.

Target Background

Function
This protein contains the viral protease responsible for cleaving the polyprotein into functional products. It also encompasses the activities necessary for replication of genomic RNA and transcription of subgenomic mRNA. This protein is covalently attached to the 5' end of the genomic and subgenomic RNAs.
Protein Families
Astroviridae polyprotein 1AB family
Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is Human Astrovirus-5 Non-structural polyprotein 1AB (ORF1) and what is its significance in astrovirus research?

Human Astrovirus-5 Non-structural polyprotein 1AB (ORF1) is a critical viral protein encoded by the first open reading frame (ORF1) of the astrovirus genome. It contains multiple functional domains including a 3C-like serine protease that plays essential roles in viral replication and protein processing. The full-length mature protein typically spans amino acids 914-1416, as seen in recombinant expression systems . This protein is significant for understanding the fundamental biology of astroviruses as it mediates crucial steps in the viral life cycle, particularly through its protease activity that processes viral polyproteins into functional components. Research on ORF1 provides insights into viral replication mechanisms and potential antiviral targets.

How is ORF1 structurally organized, and what functional domains have been identified?

ORF1 encodes a polyprotein of approximately 920 amino acids that undergoes proteolytic processing to generate multiple non-structural proteins. The protein contains several key domains:

  • The 3C-like serine protease domain, which is essential for autocatalytic processing

  • RNA-binding motifs that facilitate viral genome replication

  • Conserved sequences necessary for viral RNA replication complex formation

Research has revealed that ORF1a undergoes specific cleavage events at approximate positions near amino acids 170, 410, and 655, generating distinct processing products including p20 and p27 . The most conserved region is ORF1b, which encodes the RNA-dependent RNA polymerase, while ORF1a and ORF2 (capsid) regions show more variability across strains . This organization suggests a strategic balance between conservation of essential replication machinery and variation in proteins that interact with host immunity.

What expression systems are most effective for producing functional Recombinant Human Astrovirus-5 ORF1 proteins?

For functional expression of Recombinant Human Astrovirus-5 ORF1 proteins, E. coli systems have proven effective, particularly for specific domains or processed fragments. According to available data, recombinant expression with N-terminal His-tags facilitates purification while maintaining protein functionality . The key considerations include:

  • Codon optimization for the expression host (especially for full-length expression)

  • Temperature optimization (often lower temperatures improve folding)

  • Selection of appropriate fusion tags (His-tag being common for initial purification)

  • Expression of discrete functional domains rather than the entire polyprotein

For studying processing and protease activity, mammalian expression systems such as BHK cells using vaccinia virus-driven infection-transfection systems have provided valuable insights into authentic processing patterns . This approach allows for the creation of deletion mutants and protease-inactive variants to map cleavage sites and functional domains.

What are the critical parameters for successful purification and storage of ORF1 proteins?

Successful purification and storage of ORF1 proteins require careful attention to several parameters:

ParameterRecommended ConditionsRationale
Purification BufferTris/PBS-based buffer, pH 8.0Maintains protein stability and solubility
Additives6% TrehaloseProtects protein during freeze-thaw cycles
Storage FormLyophilized powder or in solution with glycerolPrevents degradation
Storage Temperature-20°C/-80°CMinimizes proteolytic degradation
ReconstitutionDeionized sterile water, 0.1-1.0 mg/mLEnsures proper solubilization
Long-term StorageAdd 5-50% glycerol, aliquot and store at -20°C/-80°CPrevents repeated freeze-thaw damage

Research indicates that repeated freeze-thaw cycles significantly reduce protein activity, making aliquoting essential . Working aliquots can be maintained at 4°C for up to one week without significant loss of activity. For optimal results, centrifuge vials briefly before opening to ensure all material is at the bottom of the container.

How can I experimentally determine the cleavage sites in ORF1 and confirm protease activity?

Experimental determination of cleavage sites in ORF1 requires a multi-faceted approach:

  • Expression of wild-type and mutant constructs: Create constructs expressing full-length or truncated versions of ORF1a, along with protease-inactive mutants (through substitution in the protease motif) .

  • Immunoprecipitation with domain-specific antibodies: Use antibodies targeting different regions of the polyprotein to identify processing products. This approach has successfully mapped main processing products p20 and p27 in previous studies .

  • Size-based analysis: Use SDS-PAGE to separate processing products and determine their approximate molecular weights. The p27 processing product (~28 kDa) results from cleavage at approximately positions 410 and 655 of nsP1a .

  • N-terminal sequencing: For definitive identification of exact cleavage sites, N-terminal sequencing of purified processing products is necessary.

  • Validation in multiple systems: Compare processing patterns between expression systems (e.g., vaccinia virus-driven expression in BHK cells) and authentic infection (e.g., HAstV-1 infection of Caco-2 cells) .

Research has shown that cleavages at positions approximately aa 410 and 655 are abolished when the protease motif is disrupted, confirming the autocatalytic nature of these processing events .

What cell-based models are most informative for studying ORF1 function in the context of viral replication?

Several cell-based models have proven valuable for studying ORF1 function:

  • Caco-2 cells: Human intestinal epithelial cells support productive astrovirus infection and demonstrate authentic processing patterns of nsP1a, making them the gold standard for human astrovirus studies .

  • BHK cells with vaccinia virus expression system: While not supporting natural astrovirus infection, this system allows for robust expression of viral proteins and has been validated to produce processing patterns similar to those observed in authentic infection .

  • Immunodeficient mouse models: Research using various immunocompromised mouse strains (Ifnar−/−, NSG, Rag1−/−) has revealed that persistent astrovirus infections develop in the absence of proper immune responses, highlighting the importance of adaptive immunity in viral clearance .

The choice of model system depends on the specific research question:

  • For basic processing studies: BHK or similar cells with expression vectors

  • For authentic viral replication: Caco-2 cells with viral infection

  • For pathogenesis studies: Murine models can provide insights, though species-specific differences must be considered

How do sequence variations in ORF1 between different astrovirus strains affect proteolytic processing and function?

Sequence variations in ORF1 between different astrovirus strains significantly impact both processing and function. Comparative genomic analyses of astrovirus strains have revealed:

  • Differential conservation across domains: ORF1b (encoding RNA-dependent RNA polymerase) shows higher conservation than ORF1a and ORF2, suggesting functional constraints on the polymerase but greater flexibility in other domains .

  • Strain-specific processing patterns: Different strains may exhibit variations in cleavage efficiency and processing kinetics. For example, murine astrovirus strains SJ001 and SJ002 show markedly different infection durations (21 days vs. 70 days) despite similar peak viral loads .

  • Host adaptation signatures: Strains isolated from immunocompromised hosts (like Ifnar−/− mice) may show evolutionary adaptations to reduced immune pressure, potentially affecting protease specificity and efficiency .

For experimental investigations of these variations, researchers should:

  • Perform phylogenetic analyses of ORF1 sequences from multiple strains

  • Map amino acid differences to functional domains, particularly around known cleavage sites

  • Express and characterize processing patterns of ORF1 from different strains under identical conditions

  • Assess the impact of specific substitutions through site-directed mutagenesis

What tools and techniques are available for predicting and analyzing potential ORF1 cleavage sites across astrovirus species?

Several computational and experimental approaches can be employed to predict and analyze potential ORF1 cleavage sites:

  • Sequence alignment tools: Multiple sequence alignment of ORF1 sequences from different astrovirus strains can identify conserved motifs around known cleavage sites.

  • Protease specificity prediction algorithms: Tools that predict serine protease cleavage sites based on known specificity patterns can identify potential sites in novel sequences.

  • Structural modeling: Homology modeling of the protease domain and potential substrates can provide insights into cleavage site accessibility.

  • Mass spectrometry: For experimental validation, liquid chromatography-tandem mass spectrometry (LC-MS/MS) can identify precise cleavage sites in purified proteins.

  • Mutation analysis: Systematic mutation of potential cleavage sites followed by expression and processing analysis can confirm functional importance.

Research has established that human astrovirus nsP1a undergoes cleavage at sites near amino acids 170, 410, and 655, with the latter two dependent on the viral protease activity . Similar analyses across species can reveal evolutionary patterns in protease specificity and processing strategies.

How can structural biology approaches enhance our understanding of ORF1 function and inhibitor design?

Structural biology approaches offer powerful insights into ORF1 function and provide rational bases for inhibitor design:

  • X-ray crystallography: Determination of high-resolution structures of the protease domain alone and in complex with substrates or inhibitors can reveal the molecular basis of specificity and catalysis.

  • Cryo-electron microscopy: For larger assemblies or complexes involving ORF1 proteins, cryo-EM can provide structural information without the need for crystallization.

  • Nuclear magnetic resonance (NMR): NMR studies can provide information about dynamic regions and protein-protein interactions, particularly for smaller domains or processing products.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can identify regions of ORF1 that undergo conformational changes upon binding to substrates, cofactors, or inhibitors.

For inhibitor design, structure-based approaches have proven successful for other viral proteases:

  • Virtual screening against structural models of the protease active site

  • Fragment-based drug discovery targeting allosteric sites

  • Peptide-based inhibitors mimicking natural cleavage sites

  • Covalent inhibitors targeting the catalytic serine residue

Understanding the structure-function relationships in ORF1 can also inform the design of attenuated viruses for vaccine development by introducing mutations that affect processing efficiency without completely abolishing viral replication.

What are the key challenges in developing assays to measure ORF1 protease activity for antiviral screening?

Developing robust assays for ORF1 protease activity presents several challenges:

  • Substrate complexity: The natural substrates for the protease are large polyproteins with specific recognition sequences. Designing simplified peptide substrates that retain specificity is challenging.

  • Assay format selection: Options include:

    • FRET-based peptide substrates with fluorophore-quencher pairs

    • Gel-based assays monitoring cleavage of larger protein substrates

    • Cell-based reporter systems with engineered cleavage sites

  • Protease stability: Ensuring consistent enzymatic activity throughout screening campaigns requires optimization of buffer conditions and protein stability.

  • Selectivity considerations: Distinguishing compounds that specifically inhibit the viral protease from those affecting host proteases requires careful counter-screening.

  • Validation in viral replication contexts: Compounds identified in biochemical assays must be validated in cell-based viral replication assays to confirm target engagement in a biological context.

A comprehensive screening cascade might include:

  • Primary biochemical assay with fluorescent readout

  • Secondary assays with alternative substrates

  • Cellular target engagement assays

  • Viral replication inhibition assays

  • Selectivity panels against human proteases

  • Mechanism of action studies for promising compounds

How does the immune system recognize ORF1-derived epitopes, and what are the implications for vaccine design?

Understanding immune recognition of ORF1-derived epitopes is crucial for comprehensive vaccine approaches:

  • T cell recognition: ORF1-derived peptides presented by MHC molecules can elicit CD4+ and CD8+ T cell responses. These cellular responses may be important for viral clearance even though they don't prevent initial infection.

  • Limited humoral responses: Unlike structural proteins, ORF1 proteins are primarily expressed intracellularly and typically elicit limited antibody responses during natural infection.

  • Immune evasion strategies: The rapid processing of ORF1 into smaller products may help the virus evade immune recognition of certain epitopes.

Research with murine astrovirus models has revealed important insights about immunity that may apply to human astroviruses:

  • Immunity after infection is short-lived, with animals becoming susceptible to reinfection as soon as 8-12 weeks after clearing the initial infection

  • Complete protection from reinfection was observed only at 2 weeks postclearance

  • Adaptive immune responses, particularly lymphocyte-specific responses, are critical for preventing uncontrolled virus replication

These findings suggest that effective vaccines may need to incorporate both structural and non-structural antigens to elicit broad immunity, and that regular boosting may be necessary to maintain protection.

What experimental approaches can determine whether ORF1 proteins contribute to protective immunity against astrovirus infection?

Several experimental approaches can assess the contribution of ORF1 proteins to protective immunity:

  • Recombinant protein immunization: Immunize animal models with purified recombinant ORF1 proteins or specific domains and assess protection against subsequent viral challenge.

  • DNA or viral vector vaccines: Design vaccines expressing ORF1 proteins to elicit both humoral and cellular immune responses, then evaluate protection.

  • T cell depletion studies: In animal models showing protection after immunization with ORF1 components, deplete specific T cell subsets to determine their contribution to protection.

  • Epitope mapping: Identify specific regions of ORF1 that elicit strong T cell responses in recovered individuals using peptide libraries and ELISPOT or intracellular cytokine staining.

  • Adoptive transfer experiments: Transfer T cells from immunized animals to naive recipients and assess protection against challenge.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.