Recombinant Human astrovirus-8 Non-structural polyprotein 1AB (ORF1)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of ORF1 Polyprotein

HAstV-8’s genome contains three open reading frames (ORFs), with ORF1a and ORF1b encoding non-structural polyproteins nsp1a and nsp1ab. The latter is generated via a -1 ribosomal frameshift mechanism at the ORF1a/ORF1b junction . The recombinant ORF1AB protein corresponds to residues 915–1417 of the full-length polyprotein (UniProt ID: Q9IFX2) , encompassing:

  • Protease domain: Responsible for autocatalytic cleavage of viral polyproteins .

  • VPg (Viral Protein genome-linked): Essential for RNA replication .

  • Conserved motifs: Including putative RNA helicase and transmembrane regions .

Functional Insights from Proteolytic Processing Studies

Recombinant ORF1AB has been instrumental in mapping cleavage intermediates and final products of astrovirus polyproteins:

  • Cleavage intermediates: Proteins of 145 kDa, 88 kDa, and 75 kDa identified via pulse-chase experiments .

  • Final products:

    • 57 kDa polypeptide: Likely the RNA-dependent RNA polymerase (RdRp) .

    • 27 kDa polypeptides: Putative viral proteases .

Applications in Virology Research

Recombinant ORF1AB enables:

  • Antibody production: Polyclonal antisera against ORF1a/ORF1b regions have been used to detect viral proteins in infected cells .

  • Protease activity assays: Identification of cleavage sites using mutagenesis and kinetic analyses .

  • Structural studies: Mapping coiled-coil domains and hypervariable regions (HVR) critical for replication .

Genetic Diversity and Recombination Implications

HAstV-8’s ORF1AB is a hotspot for recombination events, as observed in intergenotype recombinant strains (e.g., HAstV8/HAstV1 and HAstV8/HAstV3) . Key findings include:

  • Recombination breakpoints: Frequently localized near the ORF1b/ORF2 junction, impacting viral evolution .

  • Functional conservation: Despite sequence divergence, RdRp and protease domains remain conserved across genotypes .

Challenges and Future Directions

While recombinant ORF1AB has advanced astrovirus research, limitations persist:

  • Low solubility: The protein’s transmembrane domains complicate in vitro studies .

  • Uncharacterized motifs: The role of the N-terminal RNA helicase-like domain remains unclear .

Future work should prioritize structural resolution (e.g., cryo-EM) and high-throughput screening for antiviral drugs targeting ORF1AB’s enzymatic activities .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
ORF1; Non-structural polyprotein 1AB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
915-1417
Protein Length
Full Length of Mature Protein
Species
Human astrovirus-8 (HAstV-8)
Target Names
ORF1
Target Protein Sequence
GAQNYHSLDAWKSLLEPPRERRCVPANFPLLGHLPINRPIFDDKKPRDDLLGLLPEPTWH AFEEYGPTTWGPQAFVKSFDKFFYAEPIDFFSEYPQLCAFADWATYREFRYLEDTRVIHI TATEKNTDSTPAYPKMNYFDTEEDYLEAHGWAPYIREFTRVFKGDKPEVLWYLFLKKEII KEEKIRNSDIRQIVCADPIYTRIGACLEAHQNALMKQHTDTSVGQCGWSPMEGGFKKTMQ RLVNKGNKHFIEFDWTRYDGTIPPALFKHIKEIRWNFINKDQREKYRHVHEWYVDNLLNR HVLLPSGEVTLQTRGNPSGQFSTPMDNNMVNFWLQAFEFAYFNGPDKDLWKTYDTVVYGD DRLSTTPSVPDNYEERVITMYRDIFGMWVKPGKVICRDSIVGLSFCGFTVNENLEPVPTS PEKLMASLLKPYKILPDLESLHGKLLCYQLLAAFMAEDHPFKVYVEHCLSRTAKQLRDSG LPARLTEEQLHRIWRGGPKKCDG
Uniprot No.

Target Background

Function
This protein contains the viral protease involved in cleaving the polyprotein into functional products. It also possesses the activities necessary for replication of genomic RNA and transcription of subgenomic mRNA. Additionally, the protein is covalently attached to the 5' extremity of the genomic and subgenomic RNAs.
Protein Families
Astroviridae polyprotein 1AB family
Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is the genomic organization of Human astrovirus-8 and how does it relate to the non-structural polyprotein 1AB?

Human astrovirus-8 possesses a positive-strand RNA genome containing three open reading frames (ORFs): ORF1a, ORF1b, and ORF2. The genomic RNA is translated into two non-structural polyproteins: nsp1a (derived from ORF1a) and nsp1ab (containing sequences from both ORF1a and ORF1b) . The non-structural polyprotein 1AB spans from ORF1a through ORF1b via a ribosomal frameshifting mechanism, producing a polyprotein that contains various enzymatic domains essential for viral replication .

The polyprotein undergoes proteolytic processing to generate both intermediate and final protein products that together form the viral replication complex. The organization of these elements within ORF1 is fundamental to understanding how the virus replicates inside host cells and provides potential targets for antiviral intervention .

How are the non-structural polyproteins processed in Human astrovirus-8?

The non-structural polyproteins nsp1a and nsp1ab undergo a complex proteolytic processing pathway to yield functional viral proteins. Pulse-chase experiments have identified several cleavage intermediates during this process, including proteins of approximately 145, 88, 85, and 75 kDa . These intermediates are further processed to yield final cleavage products with molecular weights of 57, 20, and 19 kDa, as well as two products of around 27 kDa .

The 57-kDa polypeptide likely functions as the virus RNA polymerase, while the two approximately 27-kDa products are believed to serve as the viral protease . This sequential proteolytic processing is essential for generating the components of the viral replication complex, with each product having distinct roles in viral genome replication. The precise timing and regulation of this processing cascade are critical for successful viral propagation .

What functional domains have been identified within the ORF1 polyprotein?

Several critical functional domains have been identified within the ORF1 polyprotein that contribute to astrovirus replication:

DomainApproximate SizeFunctionLocation
N-terminal domainVariableAnchors replication complex to ER membraneORF1a
Protease domain~27 kDa (two products)Processes viral polyproteinsORF1a
RNA-dependent RNA polymerase~57 kDaSynthesizes viral RNAORF1b
VPg regionVariableServes as primer for RNA synthesisORF1a
Hypervariable region (HVR)VariableTolerates insertions; virus-host interactionsORF1a

The N-terminal domain plays a crucial role in anchoring the replication complex to the perinuclear ER membrane through di-arginine motifs . The viral protease facilitates the polyprotein processing, while the RNA-dependent RNA polymerase synthesizes new viral RNA during replication . Recent studies have demonstrated that the hypervariable region can tolerate insertions of reporter genes, making it valuable for developing tools to study viral replication .

What experimental approaches are most effective for studying the proteolytic processing of HAstV-8 non-structural polyprotein?

To study the proteolytic processing of HAstV-8 non-structural polyprotein, researchers employ several sophisticated experimental approaches:

  • Pulse-chase experiments: This technique involves metabolically labeling viral proteins with radioactive amino acids for a short period (pulse), followed by incubation with non-radioactive medium (chase). This approach enables researchers to track the processing of polyproteins over time, identifying both intermediate (145, 88, 85, and 75 kDa) and final cleavage products (57, 27, 20, and 19 kDa) .

  • Antisera to recombinant proteins: Generating antisera against selected recombinant proteins representing different regions of the polyprotein allows researchers to detect and characterize viral proteins in infected cells or in cells transfected with recombinant plasmids expressing the ORF1a and ORF1b polyproteins .

  • Cell culture systems: Caco-2 cells are commonly used as they support astrovirus replication. Researchers infect these cells with astrovirus or transfect them with recombinant plasmids expressing viral proteins to study their processing and localization .

  • Recombinant protein expression systems: Expression of full-length or partial polyproteins in heterologous systems like E. coli facilitates purification and biochemical characterization of these proteins, allowing for detailed functional studies .

These complementary methodologies provide a comprehensive understanding of the complex processing pathway of astrovirus non-structural polyproteins.

How can insertion of reporter genes in the ORF1a coding region be optimized for studying astrovirus replication?

Optimizing the insertion of reporter genes in the ORF1a coding region requires careful consideration of several factors to maintain virus viability while gaining useful insights:

  • Strategic selection of insertion sites: Research demonstrates that certain regions within ORF1a, particularly the hypervariable region (HVR), can better tolerate insertions. Studies have successfully inserted the improved light-oxygen-voltage (iLOV) gene at the HVR site, resulting in viable recombinant viruses .

  • Appropriate reporter gene selection: The size and properties of the reporter gene significantly impact success rates. Smaller reporter genes like iLOV (approximately 336 bp) are generally preferable over larger ones like GFP, as they are less likely to disrupt the polyprotein's structure and function .

  • Preservation of proteolytic processing sites: It is essential to ensure that the insertion does not disrupt critical proteolytic cleavage sites within the polyprotein, which would prevent proper processing and function .

  • Stability assessment: The stability of the recombinant virus should be evaluated through multiple passages. Research shows that recombinant viruses carrying iLOV fused with the HVR of ORF1a protein can maintain stability and show green fluorescence after 15 passages in cell cultures .

When properly optimized, reporter systems can serve as valuable tools for the rapid screening of antiviral drugs and visualization of viral infection and replication in living cells .

What are the current challenges in studying the membrane association of astrovirus replication complexes?

Studying the membrane association of astrovirus replication complexes presents several significant challenges that researchers must address:

  • Dynamic nature of membrane interactions: The association between viral replication complexes and cellular membranes is highly dynamic and can change throughout the viral life cycle, making it difficult to capture and characterize these interactions comprehensively .

  • Complex formation with multiple components: The replication complex involves multiple viral proteins derived from ORF1a and ORF1b, as well as cellular factors, creating an intricate network of interactions that is challenging to dissect fully .

  • Technical limitations in visualization: High-resolution imaging of membrane-associated viral complexes requires sophisticated techniques such as electron microscopy or super-resolution microscopy, which have inherent technical limitations .

  • Distinguishing direct from indirect associations: Determining whether viral proteins directly interact with membranes or are recruited through interactions with other viral or cellular proteins presents a significant challenge .

  • Identifying all membrane targeting motifs: While di-arginine motifs have been implicated in perinuclear ER retention of astrovirus replication complexes, identifying and characterizing all the motifs involved requires extensive mutational analysis and functional studies .

Addressing these challenges requires integrating advanced imaging techniques, biochemical assays, and genetic manipulation of viral genomes to systematically investigate the membrane association of astrovirus replication complexes.

How should researchers design experiments to investigate the role of specific domains within the non-structural polyprotein in viral replication?

Designing experiments to investigate domain-specific functions within the HAstV-8 non-structural polyprotein requires a comprehensive approach:

  • Targeted mutagenesis: Site-directed mutagenesis should be employed to create specific mutations within functional domains of interest. For example, mutating the di-arginine motifs in the N-terminal domain can help elucidate their role in perinuclear ER retention and replication complex formation .

  • Replicon systems: Developing astrovirus replicon systems allows for studying viral replication without producing infectious particles. This approach is particularly valuable for investigating potentially lethal mutations that might prevent virus production in a full infectious system .

  • Reverse genetics: Implementing a reverse genetics system enables the introduction of mutations into the viral genome to study their effects on viral replication and pathogenesis in the context of the complete virus life cycle .

  • Protein-protein interaction studies: Techniques such as co-immunoprecipitation or proximity ligation assays can identify interactions between different domains of the polyprotein and other viral or cellular proteins .

  • Subcellular localization studies: Immunofluorescence assays using domain-specific antibodies or tagged recombinant proteins can determine the subcellular localization of different polyprotein domains and their co-localization with cellular structures .

By integrating these approaches, researchers can comprehensively investigate the roles of specific domains within the non-structural polyprotein in viral replication and identify potential targets for antiviral intervention.

What techniques are most effective for studying recombination events in Human astrovirus ORF1?

Studying recombination events in Human astrovirus ORF1 requires sophisticated techniques and analytical approaches:

  • Whole-genome sequencing: Next-generation sequencing technologies provide high-throughput, high-resolution data that can reveal the complete genetic makeup of viral strains and identify potential recombination events .

  • Genotyping of individual genomic regions: Characterizing the genotypes of different regions (ORF1a, ORF1b, ORF2) separately and comparing them can identify discordances suggesting recombination events .

  • Recombination detection software: Specialized software tools such as SimPlot and Recombination Detection Program (RDP) can analyze sequence data to identify potential recombination breakpoints and statistically evaluate their likelihood .

StrainORF1a GenotypeORF1b GenotypeORF2 GenotypeBreakpoint Locations (nt)
CMH-N178-12HAstV5HAstV8HAstV12681 (ORF1a/ORF1b), 4357 (ORF1b/ORF2)
CMH-S059-15HAstV5HAstV8HAstV12612 (ORF1a/ORF1b), 4357 (ORF1b/ORF2)
CMH-S062-15HAstV5HAstV8HAstV12612 (ORF1a/ORF1b), 4357 (ORF1b/ORF2)
  • Phylogenetic analysis: Constructing phylogenetic trees for different regions of the viral genome can reveal incongruences that suggest recombination events. For instance, if ORF1a clusters with one genotype while ORF1b clusters with another, this suggests recombination occurred .

  • Temporal and geographical analysis: Analyzing recombinant strains in the context of their temporal and geographical distribution provides insights into the evolution and spread of recombinant viruses .

These techniques have successfully identified novel triple intergenotype recombinant HAstV strains, demonstrating the genetic diversity and evolutionary mechanisms of these viruses .

How can researchers effectively distinguish between functional and non-functional cleavage products of the HAstV-8 ORF1 polyprotein?

Distinguishing between functional and non-functional cleavage products requires a multi-faceted experimental approach:

  • Biochemical activity assays: Developing in vitro assays to measure specific enzymatic activities, such as protease activity for the 27 kDa products or RNA polymerase activity for the 57 kDa product, can directly assess functionality .

  • Dominant negative mutants: Generating mutant versions of specific cleavage products can determine their function. If a mutant interferes with viral replication when co-expressed with the wild-type virus, this suggests that the corresponding cleavage product has a functional role .

  • Complementation assays: If a mutation affecting a specific cleavage product can be complemented by providing the wild-type protein in trans, this indicates that the cleavage product is functional and required for replication .

  • Subcellular localization studies: Determining the subcellular localization of cleavage products and their co-localization with viral RNA or other components of the replication complex provides insights into potential functions. Functional proteins typically localize to sites of viral replication, such as the perinuclear ER membrane .

  • Structural studies: Determining the three-dimensional structures of cleavage products through X-ray crystallography or cryo-electron microscopy can provide insights into their potential functions based on structural similarities to known functional domains .

Through these complementary approaches, researchers can build a comprehensive understanding of which cleavage products are functional in viral replication and what specific roles they play.

How can recombinant HAstV-8 ORF1 proteins be utilized for developing diagnostic tools and antiviral strategies?

Recombinant HAstV-8 ORF1 proteins offer significant applications in diagnostics and antiviral development:

  • Serological diagnostics: Purified recombinant ORF1 proteins can serve as antigens in enzyme-linked immunosorbent assays (ELISAs) to detect antibodies against astroviruses in patient samples, helping distinguish between different astrovirus strains .

  • Production of specific antibodies: Recombinant proteins can generate specific antibodies against different domains of the ORF1 polyprotein. These antibodies serve as valuable tools for immunohistochemistry, Western blotting, or immunofluorescence assays to detect viral proteins in clinical samples .

  • High-throughput screening for antivirals: Recombinant proteins with enzymatic activities, such as the viral protease or RNA polymerase, can be used in biochemical assays to screen for inhibitory compounds, accelerating the discovery of potential antiviral drugs .

  • Structure-based drug design: Determining the three-dimensional structures of key enzymatic domains within the ORF1 polyprotein can guide the rational design of specific inhibitors .

  • Reporter virus systems: Recombinant astroviruses expressing reporter genes inserted in the ORF1a coding region, particularly in the hypervariable region, can serve as valuable tools for visualizing viral infection and for screening antiviral compounds in a physiologically relevant context .

These applications highlight the versatility of recombinant HAstV-8 ORF1 proteins as tools for understanding, diagnosing, and combating astrovirus infections.

What emerging technologies might advance our understanding of HAstV-8 ORF1 polyprotein functions?

Several emerging technologies show promise for advancing our understanding of HAstV-8 ORF1 polyprotein functions:

  • CRISPR-Cas9 genome editing: This technology enables precise modification of viral genomes and host cell factors, allowing researchers to study the effects of specific mutations on viral replication and host interactions .

  • Cryo-electron microscopy (cryo-EM): Advanced cryo-EM techniques can determine high-resolution structures of large protein complexes, potentially revealing the organization of the astrovirus replication complex and its membrane association .

  • Single-molecule techniques: Methods such as single-molecule FRET (Förster Resonance Energy Transfer) can provide insights into the dynamics of polyprotein processing and conformational changes during viral replication .

  • Proteomics approaches: Mass spectrometry-based proteomics can identify post-translational modifications of viral proteins and map protein-protein interactions within the replication complex .

  • Live-cell imaging: Advanced microscopy techniques combined with fluorescently tagged viral proteins can visualize the formation and dynamics of replication complexes in living cells .

  • Organoid systems: Three-dimensional intestinal organoids derived from human stem cells provide physiologically relevant models for studying astrovirus infection, particularly since astroviruses primarily cause gastroenteritis .

By leveraging these emerging technologies, researchers can gain deeper insights into the structure, function, and dynamics of the HAstV-8 ORF1 polyprotein and its role in viral replication.

What are the key research gaps in our understanding of HAstV-8 ORF1 polyprotein?

Several significant research gaps remain in our understanding of HAstV-8 ORF1 polyprotein:

  • Incomplete characterization of cleavage products: While some cleavage products have been identified, their complete processing pathway, exact cleavage sites, and the functions of all resulting proteins are not fully understood . Comprehensive proteomic analysis of infected cells could address this gap.

  • Limited structural information: The three-dimensional structures of most domains within the ORF1 polyprotein remain unknown, limiting our understanding of their functions and interactions . Structural biology approaches could address this limitation.

  • Unclear membrane remodeling mechanisms: While the N-terminal domain anchors the replication complex to membranes, the detailed mechanisms by which astroviruses remodel cellular membranes to create replication organelles remain poorly understood .

  • Limited understanding of host factor interactions: The cellular proteins that interact with the ORF1 polyprotein and its cleavage products, and their roles in viral replication, are largely unknown . Protein-protein interaction studies could identify these host factors.

  • Incomplete knowledge of regulatory mechanisms: The mechanisms that regulate the timing and efficiency of polyprotein processing, as well as the coordination between different viral functions, are not well characterized .

  • Limited information on strain variation: While recombination has been observed between different astrovirus strains, the functional consequences of strain-specific variations in the ORF1 polyprotein are poorly understood .

Addressing these research gaps requires a multidisciplinary approach combining molecular virology, structural biology, cell biology, and systems biology to build a comprehensive understanding of the HAstV-8 ORF1 polyprotein.

How does the structure and function of HAstV-8 ORF1 polyprotein compare to similar proteins in other positive-sense RNA viruses?

The HAstV-8 ORF1 polyprotein shares several structural and functional features with other positive-sense RNA viruses, but also exhibits unique characteristics:

Understanding these similarities and differences provides valuable insights into evolutionary relationships between virus families and can inform the development of broad-spectrum antiviral strategies.

What can studies of astrovirus recombination tell us about the evolution of the ORF1 polyprotein?

Studies of astrovirus recombination provide significant insights into the evolution of the ORF1 polyprotein:

  • Module-based evolution: Recombination patterns suggest that the ORF1 polyprotein evolves as functional modules rather than as a single unit. The observation of recombination breakpoints at specific positions (e.g., nucleotide positions 2612/2681 and 4357) indicates natural junctions between functional domains .

  • Triple intergenotype recombination: The discovery of HAstV strains that are recombinants of three different genotypes (e.g., HAstV5 in ORF1a, HAstV8 in ORF1b, and HAstV1 in ORF2) demonstrates the extensive genetic plasticity of astroviruses and highlights how different functional modules can be exchanged between strains .

  • Conservation of critical elements: Despite recombination events, certain elements of the ORF1 polyprotein remain highly conserved across different strains, suggesting that they are essential for viral replication and cannot tolerate significant variation .

  • Adaptation mechanisms: Recombination provides a mechanism for rapid adaptation to new environments or hosts by combining beneficial mutations from different viral lineages .

  • Geographical and temporal patterns: Analysis of recombinant strains across different geographical regions and time periods reveals the dynamics of astrovirus evolution and the spread of successful recombinant variants .

These insights contribute to our understanding of astrovirus diversity and evolution, with important implications for anticipating the emergence of new strains with potentially altered pathogenicity or host range.

How has our understanding of HAstV serotypes and classification evolved based on ORF1 polyprotein analysis?

Our understanding of HAstV serotypes and classification has evolved significantly through ORF1 polyprotein analysis:

Astrovirus TypeClassificationNumber of StrainsGenetic Relationship
HAstV1-8"Classic" serotypes8Genetically related
AstV-MLB1, MLB-2Novel species2Related to rat astroviruses
HMOAstVs A, B, CNovel species3Related to mink and ovine astroviruses
AstV-VA1Novel species1Related to mink and ovine astroviruses
  • Beyond serotype-based classification: Traditional classification of human astroviruses was based on serotypes (HAstV1-8). Analysis of the ORF1 polyprotein sequence has revealed greater genetic diversity, leading to the identification of novel astrovirus species that are genetically distinct from the classical serotypes .

  • Recognition of recombination's impact: The discovery of recombinant strains with different genotypes in ORF1a, ORF1b, and ORF2 has complicated classification efforts and highlighted the need for whole-genome sequencing rather than relying on partial genomic regions .

  • Cross-species transmission insights: Analysis of ORF1 sequences has revealed that some novel human astroviruses (e.g., AstV-MLB1 and MLB-2) are genetically closer to animal astroviruses than to classical human serotypes, suggesting possible cross-species transmission events .

  • Proposal for revised classification: Based on new findings from ORF1 polyprotein analysis, there have been proposals for reclassifying astroviruses to better reflect their genetic relationships rather than relying solely on serological properties .

  • Recognition of divergent clades: ORF1 polyprotein analysis has led to the identification of divergent astrovirus clades, such as the HMOAstVs (human, mink-, and ovine-like) and AstV-VA1, which exhibit distinct genetic characteristics from the classical HAstV serotypes .

These evolutionary insights from ORF1 polyprotein analysis have significantly expanded our understanding of astrovirus diversity and have important implications for diagnostic approaches and epidemiological surveillance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.