Recombinant Human Atlastin-2 (ATL2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Atlastin-2 (ATL2)

Atlastin GTPase 2 (ATL2) is a protein-coding gene in humans that participates in endoplasmic reticulum tubular network membrane organization and Golgi organization . It is an important paralog of Atlastin GTPase 1 (ATL1) . ATL2 belongs to the atlastin family of dynamin-like GTPases, which are crucial for mediating homotypic fusion of endoplasmic reticulum membranes and biogenesis of the endoplasmic reticulum tubular network .

Gene and Protein Information

The ATL2 gene, located on chromosome 8q21.13, encodes a protein that enables identical protein binding activity . The protein product of the ATL2 gene is involved in several cellular processes, including endoplasmic reticulum tubular network membrane organization and Golgi organization . Atlastins, including ATL2, form trans-homooligomers to tether membranes and mediate the fusion of endoplasmic reticulum membranes .

Aliases for ATL2 Gene
There are no aliases for the ATL2 gene in the provided documents.

External Identifiers for ATL2 Gene
There are no external identifiers for the ATL2 gene in the provided documents.

Functional Insights

ATL2 is a GTPase that tethers membranes through the formation of trans-homooligomers, mediating the homotypic fusion of endoplasmic reticulum membranes . It functions in the biogenesis of the endoplasmic reticulum tubular network . Research indicates that the major splice isoforms of ATL1 and ATL2 are autoinhibited to varying degrees . For ATL2, this autoinhibition is mapped to a C-terminal $$\alpha$$-helix .

Autoinhibition and Regulation

The fusion activity of ATL2 is regulated by autoinhibition . The most common splice isoform of ATL2, ATL2-1, exhibits minimal fusion activity due to its C-terminal extension . Removing this extension results in a 10-fold increase in fusion rate compared to ATL1 . An ATL2 splice isoform expressed in neurons differs in the inhibitory domain and demonstrates full fusion activity, indicating that alternate splicing regulates atlastin-mediated endoplasmic reticulum fusion .

Clinical Significance and Research Findings

High levels of ATL2-2 mRNA are associated with shorter breast cancer-specific survival in patients with estrogen-receptor-positive luminal breast tumors . Clinicopathological analyses have shown a strong association between ATL2-2 mRNA levels and tumor size, grade, and molecular subtype . High ATL2 mRNA levels correlate with the upregulation of MYC targets v1, E2F targets, and G2M checkpoint genes, suggesting that ATL2-2 may support breast cancer progression through key cancer driver pathways .

Key Biological Activities

ATL2 is associated with multiple biological activities, including:

  • Endoplasmic Reticulum Organization: ATL2 is involved in the organization of the endoplasmic reticulum tubular network membrane .

  • Golgi Organization: ATL2 plays a role in Golgi organization .

  • Protein Binding: ATL2 enables identical protein binding activity .

  • Fusion Activity: ATL2 mediates the fusion of endoplasmic reticulum membranes, a process regulated by autoinhibition and alternative splicing .

Atlastin-2 in Liposome Fusion

The ATL2-2 isoform supports liposome fusion . Peptides derived from the C-terminal helix of ATL2-1 inhibit fusion, whereas peptides from ATL2-2 do not affect fusion, further demonstrating the regulatory role of the C-terminal helix in ATL2 function .

Role in Apoptosis

Research indicates that certain compounds can affect cell cycle arrest of cancer cell lines . One such compound induces time-dependent and dose-dependent cleavage of poly ADP-ribose polymerase (PARP), and also induces a dose-dependent increase in caspase-3 and caspase-8 activity, but has little effect on caspase-9 protease activity in HepG2 cells . These results provide evidence that apoptosis in HepG2 cell is caspase-8-dependent .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If a specific tag type is required, please inform us, and we will prioritize its inclusion in the production process.
Synonyms
ATL2; ARL6IP2; Atlastin-2; ADP-ribosylation factor-like protein 6-interacting protein 2; ARL-6-interacting protein 2; Aip-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-583
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
ATL2
Target Protein Sequence
MAEGDEAARGQQPHQGLWRRRRTSDPSAAVNHVSSTTSLGENYEDDDLVNSDEVMKKPCP VQIVLAHEDDHNFELDEEALEQILLQEHIRDLNIVVVSVAGAFRKGKSFLLDFMLRYMYN KDSQSWIGGNNEPLTGFTWRGGCERETTGIQVWNEVFVIDRPNGTKVAVLLMDTQGAFDS QSTIKDCATVFALSTMTSSVQVYNLSQNIQEDDLQHLQLFTEYGRLAMEEIYQKPFQTLM FLIRDWSYPYEHSYGLEGGKQFLEKRLQVKQNQHEELQNVRKHIHNCFSNLGCFLLPHPG LKVATNPSFDGRLKDIDEDFKRELRNLVPLLLAPENLVEKEISGSKVTCRDLVEYFKAYI KIYQGEELPHPKSMLQATAEANNLAAVAGARDTYCKSMEQVCGGDKPYIAPSDLERKHLD LKEVAIKQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFYAARTPATLFA VMFAMYIISGLTGFIGLNSIAVLCNLVMGLALIFLCTWAYVKYSGEFREIGTVIDQIAET LWEQVLKPLGDNLMEENIRQSVTNSIKAGLTDQVSHHARLKTD
Uniprot No.

Target Background

Function
Atlastin-2 (ATL2) is a GTPase that tethers membranes through the formation of trans-homooligomers and mediates homotypic fusion of endoplasmic reticulum membranes. It plays a crucial role in endoplasmic reticulum tubular network biogenesis.
Gene References Into Functions
  1. Studies indicate varying capacities of ATLs in mediating endoplasmic reticulum fusion, with ATL1 demonstrating the strongest effect and ATL3 the weakest. PMID: 25773277
  2. The role of GTP hydrolysis in the ATL2 fusion mechanism requires further investigation, particularly concerning the correlation between the observed behavior of the soluble ATL2 domain and the full-length, membrane-bound protein. PMID: 22065636
  3. Atlastin-2 and -3, closely related human GTPases to atlastin-1, have been described. PMID: 18270207
Database Links

HGNC: 24047

OMIM: 609368

KEGG: hsa:64225

STRING: 9606.ENSP00000368237

UniGene: Hs.594950

Protein Families
TRAFAC class dynamin-like GTPase superfamily, GB1/RHD3-type GTPase family, GB1 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in peripheral tissues (at protein level).

Q&A

What are the key domains of Recombinant Human Atlastin-2 and their functions?

Recombinant Human Atlastin-2 contains several critical functional domains: an N-terminal GTPase domain, a middle domain with a three-helix bundle, two closely spaced transmembrane domains, and a C-terminal cytoplasmic tail. The GTPase domain is responsible for nucleotide hydrolysis, while the middle domain participates in protein oligomerization and enhances GTPase activity. The transmembrane domains anchor the protein to the ER membrane, and the C-terminal cytoplasmic tail is essential for membrane fusion activity. Studies have demonstrated that deletion of the C-terminal cytoplasmic domain completely abolishes fusion activity despite maintaining GTPase functionality .

How does ATL2 oligomerization relate to its function?

ATL2 oligomerization is nucleotide-dependent and critical for its fusion activity. Experimental evidence indicates that atlastin dimerizes in the presence of GTPγS (a non-hydrolyzable GTP analog) but remains monomeric with GDP or without nucleotide . This oligomerization requires the juxtamembrane middle domain three-helix bundle, which also supports efficient GTPase activity. The functional cycle involves GTP-dependent dimerization generating an enzymatically active protein that drives membrane fusion after nucleotide hydrolysis and conformational reorganization . This mechanism enables atlastin in adjacent membranes to associate, bringing ER membranes into molecular contact for fusion.

What is the molecular basis for GTP hydrolysis in ATL2?

ATL2, like other atlastin family members, possesses an intramolecular arginine finger that stimulates GTP hydrolysis when correctly oriented through rearrangements within the G domain . This intrinsic regulatory mechanism is crucial for the protein's function. Crystal structures have revealed that the arginine finger's positioning depends on conformational changes within the GTPase domain, allowing precise control of hydrolysis timing . Disruption of this mechanism through mutations has been linked to hereditary neurodegenerative diseases, highlighting its physiological importance.

What methodologies are most effective for studying ATL2 conformational dynamics?

For investigating ATL2 conformational changes, Förster Resonance Energy Transfer (FRET) has proven highly effective. This approach allows researchers to monitor nucleotide binding and hydrolysis-driven conformational changes in real-time . When designing FRET experiments with ATL2:

  • Strategic placement of fluorophores at sites that undergo significant distance changes during conformational shifts

  • Testing protein function with fluorophores to ensure labeling doesn't disrupt activity

  • Using appropriate nucleotide analogs (GTP, GDP, GTPγS) to capture different states in the reaction cycle

Additionally, crystallographic approaches have successfully captured different conformational states, particularly when using nucleotide analogs to stabilize specific arrangements .

How should researchers design domain-specific functional studies for ATL2?

When investigating domain-specific functions of ATL2, systematic truncation and mutation approaches are recommended. Based on experimental evidence, researchers should:

  • Generate precise domain truncations (e.g., removing the C-terminal cytoplasmic domain or specific transmembrane regions)

  • Confirm protein expression and stability through western blotting

  • Assess GTPase activity of truncated variants using enzymatic assays

  • Evaluate membrane fusion capacity using reconstituted proteoliposome systems

  • Compare in vitro findings with in vivo cellular assays

This approach has successfully demonstrated that the C-terminal cytoplasmic tail is absolutely required for fusion activity, even though truncation mutants retain ~70% of wild-type GTPase activity . These findings highlight the importance of testing both enzymatic and fusion activities when characterizing domain functions.

How can researchers effectively analyze contradictions in ATL2 experimental data?

When encountering contradictory results in ATL2 research, a structured approach to data contradiction analysis is essential. Consider implementing a notation system using parameters (α, β, θ) where:

  • α represents the number of interdependent experimental variables

  • β represents the number of contradictory dependencies identified

  • θ represents the minimal number of required Boolean rules to assess these contradictions

This structure helps handle the complexity of multidimensional interdependencies within research datasets. For ATL2 specifically, researchers should:

  • Systematically document experimental conditions (protein constructs, buffer conditions, nucleotides, membrane compositions)

  • Identify patterns in seemingly contradictory results

  • Test minimal hypotheses that could reconcile disparate findings

  • Consider whether contradictions represent different states in a complex reaction cycle rather than true inconsistencies

For example, evidence that ATL2 can adopt both pre- and post-fusion conformations in the presence of GTP analogs initially appeared contradictory but was later recognized as representing different states in a dynamic equilibrium .

What expression systems optimize yield and functionality of recombinant ATL2?

Expression SystemAdvantagesChallengesRecommended for
E. coliHigh yield, economical, rapid expressionMay lack post-translational modifications, inclusion body formationCytoplasmic domains, structural studies
Insect cellsBetter folding, suitable for membrane proteinsHigher cost, longer timelineFull-length protein, functional studies
Mammalian cellsNative post-translational modificationsLowest yield, highest costIn vivo trafficking studies

What are the critical parameters for reconstituting ATL2 into liposomes for functional studies?

Successful reconstitution of ATL2 into liposomes requires careful attention to multiple parameters:

  • Lipid composition: Synthetic phosphatidylcholine:phosphatidylserine (PCPS) liposomes have been effectively used for ATL2 reconstitution . The lipid composition should mimic the ER membrane environment.

  • Protein-to-lipid ratio: Typically, a ratio between 1:200 and 1:1000 (w/w) is used, with optimization required for each specific assay.

  • Reconstitution method: Detergent-mediated reconstitution with controlled detergent removal (using dialysis or adsorbent beads) ensures proper protein orientation.

  • Buffer conditions: The reconstitution buffer should maintain protein stability while allowing for subsequent functional assays. Typically, buffers containing 25-50 mM Tris or HEPES (pH 7.4), 100-150 mM NaCl, and 1 mM DTT are used.

  • Verification methods: After reconstitution, researchers should verify:

    • Protein incorporation efficiency

    • Protein orientation in the membrane

    • Liposome size distribution

    • Maintenance of GTPase activity

These parameters directly impact the success of subsequent functional assays, particularly membrane fusion experiments .

How should researchers design GTPase activity assays for ATL2?

For rigorous assessment of ATL2 GTPase activity, multiple complementary approaches are recommended:

  • Colorimetric phosphate release assays: Measuring released inorganic phosphate using malachite green or similar reagents provides quantitative measurement of GTP hydrolysis rates.

  • HPLC-based nucleotide conversion assays: Directly measuring the conversion of GTP to GDP provides accurate kinetic information, especially useful for comparing wild-type and mutant proteins.

  • Fluorescent GTP analogs: Using mant-GTP (N-methylanthraniloyl-GTP) or similar fluorescent analogs allows real-time monitoring of nucleotide binding and hydrolysis .

When designing these assays, researchers should:

  • Include appropriate controls (no enzyme, non-hydrolyzable GTP analogs)

  • Ensure linear reaction conditions (appropriate enzyme concentration and time course)

  • Consider the impact of dimerization on activity

  • Test activity across a range of nucleotide concentrations to determine kinetic parameters (Km, Vmax)

It's worth noting that the middle domain significantly influences GTPase activity, and truncation mutants lacking this domain show reduced activity despite retaining the core GTPase domain .

How does ATL2's nucleotide exchange mechanism differ from other GTPases?

ATL2 possesses a unique nucleotide exchange mechanism that is intrinsic to its N-terminal domains, distinguishing it from many other GTPases that require separate guanine nucleotide exchange factors (GEFs). Research has discovered that the middle domain plays a critical role in this process, facilitating nucleotide loading into the G domain . This intrinsic exchange capability allows ATL2 to control its own activation cycle.

Experimental evidence demonstrates that:

  • The isolated G domain fails to bind mant-GTP or mant-GppNHp under typical conditions

  • The middle domain, when added in trans, rescues mant-GTP binding, albeit with weaker affinity than the intact cytoplasmic unit

  • This intrinsic exchange mechanism coordinates the timing of homotypic interactions through GTP binding and hydrolysis cycles

This mechanism represents a fundamental difference from Ras-like small GTPases or heterotrimeric G-proteins, which typically require separate exchange factors to catalyze nucleotide release.

What methods best capture the membrane fusion activity of ATL2 in vitro?

For quantitative assessment of ATL2-mediated membrane fusion, several complementary techniques should be employed:

  • Lipid mixing assays: Incorporating fluorescent lipid pairs (such as NBD-PE and Rhodamine-PE) into donor vesicles enables FRET-based detection of lipid mixing upon fusion with unlabeled acceptor vesicles . This approach provides kinetic information about the fusion process.

  • Content mixing assays: Using self-quenching fluorescent dyes encapsulated within vesicles allows measurement of aqueous content mixing, confirming complete fusion rather than just hemifusion.

  • Light scattering measurements: Changes in vesicle size during fusion can be monitored by dynamic light scattering, providing complementary physical evidence of the fusion process.

  • Electron microscopy visualization: Negative staining or cryo-EM can provide direct visual evidence of vesicle morphology changes and fusion events.

When designing these assays, researchers should carefully control:

  • Protein:lipid ratios in reconstituted proteoliposomes

  • Nucleotide concentrations (typically 1-2 mM GTP)

  • Buffer conditions (particularly divalent cation concentrations)

  • Temperature (fusion efficiency is often temperature-dependent)

These in vitro fusion assays have successfully demonstrated that the C-terminal cytoplasmic tail of atlastin is absolutely required for fusion activity, even when GTPase activity is largely preserved .

How can researchers effectively use inhibitory fragments to study ATL2 mechanism?

When utilizing inhibitory fragments:

  • Domain selection: Include both the GTPase domain and middle domain for maximum effect; fragments lacking either domain show significantly reduced inhibition.

  • Concentration titration: Establish dose-response relationships by testing a range of inhibitor concentrations (typically 0.1-10 μM).

  • Pre-incubation strategy: Determine whether pre-incubation with the fragment before adding GTP enhances inhibition, suggesting competition for initial binding sites.

  • Nucleotide dependence: Test inhibition in the presence of different nucleotides (GTP, GDP, GTPγS) to identify state-specific effects.

  • Mutational analysis: Compare wild-type fragments with those containing specific mutations to identify critical residues for the inhibitory effect.

This approach has revealed that GTP-dependent dimerization is essential for the fusion mechanism, as soluble fragments can sequester full-length ATL2 into non-productive complexes .

What are common pitfalls when working with transmembrane domains of ATL2?

Working with the transmembrane domains of ATL2 presents several challenges that researchers should anticipate:

  • Protein aggregation: The hydrophobic nature of transmembrane domains often leads to aggregation during expression, purification, and reconstitution. To minimize this:

    • Use mild detergents (DDM, LMNG) during purification

    • Maintain detergent above critical micelle concentration throughout handling

    • Consider using fusion partners that enhance solubility

    • Avoid freeze-thaw cycles once in detergent solution

  • Incorrect orientation in liposomes: Random insertion during reconstitution can result in mixed orientations, complicating functional assays. Solutions include:

    • Using asymmetric reconstitution methods

    • Developing assays that are orientation-independent

    • Employing proteolytic digestion to confirm topology

  • Incomplete detergent removal: Residual detergent can destabilize liposomes and interfere with fusion assays. Recommended approaches:

    • Use Bio-Beads or similar adsorbents with defined protocols

    • Dialyze extensively against detergent-free buffer

    • Verify detergent removal using appropriate analytical methods

Truncations that preserve at least one transmembrane domain (e.g., atl(1-471)) maintain membrane anchoring while allowing investigation of domain-specific functions. These constructs retain substantial GTPase activity (~70% of wild-type) but completely lose fusion capacity, highlighting the importance of the C-terminal domain .

How can researchers distinguish between fusion defects and GTPase defects?

Distinguishing between fusion defects and GTPase defects is critical for accurately interpreting ATL2 experiments. Research has demonstrated that these activities, while linked, can be experimentally separated . A systematic approach includes:

AssessmentMethodExpected Result for GTPase DefectExpected Result for Fusion-Specific Defect
GTP hydrolysisPhosphate release assaySignificantly reducedNear wild-type levels
GTP bindingFluorescent nucleotide bindingReduced/altered binding kineticsNormal binding
Protein dimerizationSize exclusion chromatography with GTPγSImpaired dimerizationMay dimerize normally
Membrane fusionLipid mixing assayNo fusionNo fusion

C-terminal truncation mutants of atlastin provide an excellent example of fusion-specific defects. These constructs (atl(1-471) and atl(1-450)) retain ~70% of wild-type GTPase activity but are completely incapable of driving membrane fusion . This indicates that while GTPase activity is necessary for fusion, it is not sufficient, and the C-terminal domain plays a fusion-specific role.

When troubleshooting experiments where fusion activity is absent despite GTPase activity:

  • Verify protein orientation in the membrane

  • Examine oligomerization status with different nucleotides

  • Consider whether the C-terminal domain might be compromised

  • Test for potential inhibitory factors in the reconstitution system

What controls are essential in ATL2-mediated membrane fusion experiments?

Rigorous control experiments are critical for reliable interpretation of ATL2 fusion assays. Essential controls include:

  • Nucleotide controls:

    • GTPγS (non-hydrolyzable analog): Should support dimerization but not complete fusion

    • GDP: Should not support fusion

    • No nucleotide: Baseline activity level

    • ATP: Specificity control to confirm GTP requirement

  • Protein controls:

    • Heat-inactivated ATL2: Controls for non-specific effects of protein presence

    • GTPase-deficient mutant (e.g., K80A): Separates GTP binding from hydrolysis effects

    • Soluble cytoplasmic domain: Should inhibit fusion in a concentration-dependent manner

    • C-terminal truncation: Should show GTPase activity without fusion

  • Membrane composition controls:

    • Varying lipid compositions to test dependency on specific lipids

    • Protein-free liposomes to establish baseline spontaneous fusion rate

    • Asymmetric liposome populations to confirm requirement for ATL2 in both membranes

  • Technical controls:

    • Detergent controls for lipid mixing assays (maximum signal)

    • Time-resolved measurements to capture kinetics

    • Parallel content mixing assays to confirm complete fusion

By systematically implementing these controls, researchers can confidently distinguish ATL2-mediated fusion from artifacts and precisely characterize the mechanistic requirements for this process .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.