Recombinant Human Atlastin-3 (ATL3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Atlastin-3 (ATL3)

Atlastin-3 (ATL3) is a GTPase that facilitates the fusion of endoplasmic reticulum (ER) membranes, promoting membrane tethering through the formation of trans-oligomers . It is a key component in the biogenesis of the ER tubular network and may also have a role in regulating Golgi biogenesis .

Functional Characteristics

ATL3 belongs to the atlastin family of GTPases, which are essential for maintaining the structure of the endoplasmic reticulum (ER) in metazoans . The ER is a dynamic network of tubules and cisternae responsible for protein synthesis, folding, and lipid metabolism. Atlastins, including ATL3, mediate the homotypic fusion of ER membranes, which is crucial for the formation and maintenance of the ER network .

Key functional aspects of ATL3 include:

  • Membrane Fusion Catalyst: ATL3 acts as a robust catalyst for membrane fusion, essential for sustaining the ER network structure in cells .

  • Constitutive Activity: Unlike ATL1 and ATL2, ATL3 lacks C-terminal autoinhibition, suggesting it functions as a constitutive ER fusion catalyst .

  • ER Network Maintenance: ATL3 is sufficient to restore and maintain the tubular ER network in cells where all three ATLs (ATL1, ATL2, and ATL3) have been knocked out .

Role in ER Fusion

ATL3 plays a critical role in ER fusion, which is essential for maintaining the ER network. The ER network's structure is sustained by homotypic membrane fusion, a process catalyzed by atlastin GTPases .

ATL3 contributes to this process by:

  • Catalyzing Membrane Fusion: Purified human ATL3 can efficiently catalyze membrane fusion in vitro, demonstrating its capability to drive ER network formation .

  • Maintaining ER Structure: In cells lacking ATL1 and ATL2, exogenous expression of ATL3 alone can restore and maintain the tubular ER network, highlighting its importance in ER structure maintenance .

Involvement in Cellular Processes

Beyond its role in ER fusion, ATL3 is implicated in various cellular processes:

  • ER-Autophagy Receptor: ATL3 may function as an ER-autophagy receptor, interacting with GABARAP proteins. Disruptions in this interaction have been linked to hereditary sensory neuropathy (HSN) disease .

  • Protein Targeting and Export: ATL3, along with ATL2, is involved in protein targeting to the inner nuclear membrane and protein export from the ER .

  • Autophagy Regulation: ATL2 and ATL3 regulate both selective and nonselective autophagy by interacting with ULK1 and ATG13 .

  • Flavivirus Replication: ATL3 interacts with both nonstructural and structural viral proteins, suggesting a role in flavivirus replication .

Research Findings and Studies

StudyFindings
Bryce et al. (2023) Demonstrated that purified human ATL3 catalyzes efficient membrane fusion in vitro and is sufficient to sustain the ER network in triple knockout cells. Unlike ATL1/2, ATL3 lacks C-terminal autoinhibition, indicating it is a constitutive ER fusion catalyst.
O'Donnell et al. (2017) Identified discrete temporal steps in the catalytic cycle for ATL1 and ATL3, revealing a conserved progression of molecular events from nucleotide binding and hydrolysis to ATL dimerization and phosphate release. The crystal structure of ATL3 suggests a mechanism for the displacement of the catalytic $$Mg^{2+}$$ ion following GTP hydrolysis.
Chen et al. (2019) as cited in Bryce et al. (2023) Implicated ATL3 as a possible ER-autophagy receptor that interacts with GABARAP proteins, with HSN disease mutations disrupting this interaction.
Pawar et al. (2017) and Niu et al. (2019) as cited in Bryce et al. (2023) Showed that ATL2/3 depletion impairs protein targeting to the inner nuclear membrane and protein export from the ER.
Liang et al. (2018) and Liu et al. (2021) as cited in Bryce et al. (2023) Found that ATL2/3 regulates both selective and nonselective autophagy through interactions with ULK1 and ATG13.
Monel et al. (2019) and Neufeldt et al. (2019) as cited in Bryce et al. (2023) Demonstrated interactions between ATL3 and both nonstructural and structural viral proteins, linking ATL3 to flavivirus replication.

Potential Therapeutic Applications

While research on ATL3 is still evolving, its involvement in various cellular processes suggests potential therapeutic applications. Targeting ATL3 could offer new strategies for treating diseases related to ER dysfunction, autophagy, and viral infections.

  • Neurological Disorders: Given ATL3's role in maintaining ER structure and its association with hereditary sensory neuropathy, modulating its activity could be beneficial in treating neurological disorders .

  • Infectious Diseases: The interaction between ATL3 and flaviviruses suggests that targeting ATL3 could disrupt viral replication, offering a potential therapeutic strategy for flaviviral infections .

  • Cancer: ATL3's involvement in autophagy regulation indicates that it could be a target for cancer therapy, as autophagy plays a critical role in cancer cell survival and proliferation .

Product Specs

Form
Lyophilized powder

Note: While we will prioritize shipping the format currently in stock, please specify any format requirements in your order notes. We will fulfill requests to the best of our ability.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All protein shipments default to blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.

Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion in the production process.

Synonyms
ATL3; Atlastin-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-541
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
ATL3
Target Protein Sequence
MLSPQRVAAAASRGADDAMESSKPGPVQVVLVQKDQHSFELDEKALASILLQDHIRDLDV VVVSVAGAFRKGKSFILDFMLRYLYSQKESGHSNWLGDPEEPLTGFSWRGGSDPETTGIQ IWSEVFTVEKPGGKKVAVVLMDTQGAFDSQSTVKDCATIFALSTMTSSVQIYNLSQNIQE DDLQQLQLFTEYGRLAMDEIFQKPFQTLMFLVRDWSFPYEYSYGLQGGMAFLDKRLQVKE HQHEEIQNVRNHIHSCFSDVTCFLLPHPGLQVATSPDFDGKLKDIAGEFKEQLQALIPYV LNPSKLMEKEINGSKVTCRGLLEYFKAYIKIYQGEDLPHPKSMLQATAEANNLAAAASAK DIYYNNMEEVCGGEKPYLSPDILEEKHCEFKQLALDHFKKTKKMGGKDFSFRYQQELEEE IKELYENFCKHNGSKNVFSTFRTPAVLFTGIVALYIASGLTGFIGLEVVAQLFNCMVGLL LIALLTWGYIRYSGQYRELGGAIDFGAAYVLEQASSHIGNSTQATVRDAVVGRPSMDKKA Q
Uniprot No.

Target Background

Function

Atlastin-3 (ATL3) is a GTPase that tethers membranes through the formation of trans-homooligomers and mediates homotypic fusion of endoplasmic reticulum membranes. It plays a crucial role in endoplasmic reticulum tubular network biogenesis.

Gene References Into Functions
  1. Research indicates that Sey1/Atl3 and Rtn4 localize to early Legionella-containing vacuoles (LCVs) and are essential for pathogen vacuole formation; Sey1/Atl3-dependent ER remodeling contributes to LCV maturation and intracellular replication of Legionella pneumophila. PMID: 28835546
  2. Studies suggest that the three ATLs exhibit varying capacities for mediating endoplasmic reticulum fusion, with ATL1 demonstrating the strongest capacity and ATL3 the weakest. PMID: 25773277
  3. ATL3 is implicated in the structural organization of intracellular organelles, which may be critical for axonal survival. PMID: 24459106
  4. A family of human GTPases, atlastin-2 and -3, closely related to atlastin-1, has been described. PMID: 18270207
Database Links

HGNC: 24526

OMIM: 609369

KEGG: hsa:25923

STRING: 9606.ENSP00000381844

UniGene: Hs.356719

Involvement In Disease
Neuropathy, hereditary sensory, 1F (HSN1F)
Protein Families
TRAFAC class dynamin-like GTPase superfamily, GB1/RHD3-type GTPase family, GB1 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the central nervous system and in dorsal root ganglia neurons. Expressed in peripheral tissues (at protein level).

Q&A

What is Human Atlastin-3 (ATL3) and what is its primary function?

Human Atlastin-3 (ATL3) is one of three human atlastin paralogs (ATL1, ATL2, and ATL3) that functions as a GTPase involved in endoplasmic reticulum (ER) membrane dynamics. Its primary function is catalyzing homotypic membrane fusion, which is essential for maintaining the branched ER network structure in metazoans. Recent research has demonstrated that ATL3 is a robust membrane fusion catalyst that can efficiently maintain ER network structure, contrary to earlier beliefs that it was a weak fusogen . ATL3 plays a critical role in ER homeostasis by mediating the fusion of ER tubules at junction points, thereby helping maintain the complex three-dimensional architecture of the ER.

How does ATL3 differ from other human atlastin paralogs?

The most significant difference between ATL3 and the other human atlastin paralogs (ATL1 and ATL2) is in their regulatory mechanisms:

  • C-terminal regulation: While ATL1 and ATL2 are C-terminally autoinhibited (requiring relief of this inhibition for activation), ATL3 lacks any detectable C-terminal autoinhibition . This makes ATL3 similar to the invertebrate Drosophila ATL ortholog.

  • Evolutionary status: Phylogenetic analysis indicates that C-terminal autoinhibition is a recent evolutionary innovation. ATL3 represents the more ancestral, constitutive fusion mechanism, while ATL1/2 autoinhibition likely evolved in vertebrates as a means of conditionally upregulating ER fusion activity .

  • Functional implications: ATL3 serves as a constitutive ER fusion catalyst, providing baseline maintenance of the ER network, while ATL1 and ATL2 can be regulated to increase fusion activity in response to specific cellular demands .

This fundamental difference in regulation has important implications for understanding how cells maintain and dynamically remodel their ER networks.

What cellular processes involve ATL3 beyond ER membrane fusion?

Beyond its primary role in ER membrane fusion, ATL3 has been implicated in several other cellular processes:

  • ER-autophagy: ATL3 may function as an ER-autophagy receptor through interactions with GABARAP proteins, with Hereditary Sensory Neuropathy (HSN) disease mutations disrupting this interaction .

  • Nuclear membrane dynamics: ATL3 contributes to protein targeting to the inner nuclear membrane .

  • Protein trafficking: ATL3 depletion impairs protein export from the ER .

  • Autophagy regulation: ATL3 plays roles in both selective and nonselective autophagy, the latter through ATL3 interactions with ULK1 and ATG13 .

  • Viral replication: ATL3 has been linked to flavivirus replication through interactions with both nonstructural and structural viral proteins .

These diverse functions highlight the importance of ATL3 in maintaining cellular homeostasis beyond just ER structural integrity.

How should in vitro fusion assays be designed to study ATL3 activity?

When designing in vitro fusion assays to study ATL3 activity, researchers should consider the following methodological approach:

  • Proteoliposome preparation:

    • Incorporate purified recombinant ATL3 into artificial liposomes with lipid compositions mimicking the ER membrane

    • For fluorescence-based assays, include NBD-labeled lipids in donor liposomes

  • Experimental procedure:

    • Pre-incubate proteoliposomes at 37°C for 5 minutes in buffer containing 5 mM MgCl₂

    • Add 2 mM GTP to initiate fusion

    • Monitor NBD dequenching at 10-second intervals for 60 minutes (excitation at 460 nm, dequenching at 538 nm)

  • Controls:

    • Non-GTP control to establish baseline

    • Maximum dequenching control using detergent (0.5% Anapoe X-100)

    • Negative controls using fusion-defective ATL3 mutants

  • Data analysis:

    • Calculate fusion using the formula: Fusion = ((Fluorescence observed - Initial fluorescence observed) / Maximum fluorescence) × 100

    • Plot time courses and calculate initial rates

This experimental design allows for quantitative assessment of ATL3 fusion activity and enables comparisons between different conditions or mutant constructs.

What statistical considerations are important when analyzing ATL3 experimental data?

Following these statistical considerations ensures robust and reproducible results in ATL3 research.

How can cellular assays be designed to study ATL3 function in vivo?

To study ATL3 function in cellular contexts, consider these experimental approaches:

  • Genetic manipulation strategies:

    • CRISPR/Cas9-mediated knockout of ATL3 alone or in combination with ATL1/2

    • siRNA or shRNA-mediated knockdown for transient depletion

    • Overexpression of wild-type or mutant ATL3 variants

  • Rescue experiments:

    • Use ATL1/2/3 triple knockout cells (such as E5 NIH-3T3)

    • Reintroduce wild-type or mutant ATL3

    • Assess ER network restoration through imaging

  • ER morphology analysis:

    • Fluorescent markers for ER visualization (e.g., Sec61β-GFP)

    • Confocal or super-resolution microscopy

    • Quantitative analysis of ER network parameters (tubule length, junction density)

  • Protein-protein interaction studies:

    • Co-immunoprecipitation of ATL3 with potential binding partners

    • Proximity ligation assays

    • FRET-based interaction assays

  • Dynamic studies:

    • Fluorescence recovery after photobleaching (FRAP) to measure ER continuity

    • Live-cell imaging to capture ER remodeling events

    • Photoactivatable or photoswitchable fluorescent proteins to track protein movement

These cellular approaches complement in vitro studies and provide insights into ATL3 function within its native environment.

How does the lack of C-terminal autoinhibition affect ATL3 function compared to ATL1/2?

The absence of C-terminal autoinhibition in ATL3 creates fundamental functional differences compared to ATL1/2:

  • Constitutive activity profile:

    • ATL3 functions as a constitutive ER fusion catalyst without requiring regulatory activation

    • Unlike ATL1/2, ATL3's fusion activity is not enhanced by C-terminal truncation

  • Experimental evidence:

    • When ATL3 is truncated at position 516 (ATL3ΔC, removing residues beyond the amphipathic helix), there is no significant change in fusion rate or GTPase activity

    • This contrasts sharply with ATL1, where C-terminal deletion substantially stimulates fusion activity

ATL ParalogEffect of C-terminal TruncationFusion Activity
ATL1Substantial increaseRegulated
ATL2Substantial increaseRegulated
ATL3No significant effectConstitutive
  • Functional implications:

    • ATL3 likely provides baseline, continuous ER fusion activity

    • ATL1/2 provide conditional, regulatable fusion activity that can be upregulated when needed

    • This dual system allows for both maintenance and dynamic remodeling of the ER network

This fundamental difference suggests ATL3 evolved as a housekeeping fusion catalyst, while ATL1/2 developed regulatory mechanisms to respond to specific cellular demands.

What approaches can be used to study disease-associated ATL3 mutations?

To study disease-associated ATL3 mutations, particularly those linked to Hereditary Sensory Neuropathy (HSN), researchers can employ a multi-faceted approach:

  • In vitro biochemical characterization:

    • Express and purify recombinant wild-type and mutant ATL3 proteins

    • Assess GTPase activity using colorimetric phosphate release assays

    • Evaluate membrane fusion efficiency using fluorescence-based liposome assays

    • Determine protein stability and folding by circular dichroism or thermal shift assays

  • Structural analysis:

    • X-ray crystallography or cryo-EM to determine structural perturbations

    • Molecular dynamics simulations to predict conformational changes

    • Analysis of dimer formation using size exclusion chromatography or analytical ultracentrifugation

  • Cellular studies:

    • Express disease mutations in ATL1/2/3 triple knockout cells to assess ER network restoration capacity

    • Analyze subcellular localization and dynamics using fluorescence microscopy

    • Investigate effects on ER stress responses and unfolded protein response pathways

  • Interaction studies:

    • Determine if mutations affect known binding partners (e.g., GABARAP for HSN mutations)

    • Identify altered interaction networks using proximity labeling approaches

    • Study effects on homo- and hetero-oligomerization with other atlastin paralogs

  • Neuronal models:

    • Generate patient-derived neurons using iPSC technology

    • Create transgenic animal models expressing ATL3 mutations

    • Analyze axonal transport, neuronal development, and sensory function

This comprehensive approach enables understanding of how specific mutations lead to disease pathology and may identify potential therapeutic targets.

How can contradictions between in vitro and cellular studies of ATL3 be reconciled?

Researchers often encounter seemingly contradictory results between in vitro biochemical studies and cellular observations of ATL3. These can be reconciled through systematic analysis:

  • Examples of contradictions:

    • Earlier studies suggested ATL3 was a weak fusogen in vitro, but more recent work demonstrates efficient fusion activity

    • Some studies found ATL3 insufficient to maintain ER morphology, while others showed it can restore ER networks in triple knockout cells

  • Methodological considerations:

    • Protein preparation: Different purification methods may affect protein activity

    • Assay conditions: Buffer composition, temperature, and lipid environment significantly impact membrane fusion

    • Expression levels: Cellular studies may be affected by non-physiological expression levels

  • Biological factors:

    • Compensatory mechanisms: Cells may adapt to ATL deficiency through upregulation of other ER-shaping proteins

    • Cell-type specificity: Different cell types have varying requirements for atlastin function

    • Functional redundancy: The three atlastin paralogs have overlapping but distinct functions

  • Reconciliation strategies:

    • Directly compare methodologies when conflicting results arise

    • Use multiple complementary approaches to validate findings

    • Consider the biological context when interpreting results

    • Design experiments that bridge in vitro and cellular systems

By carefully analyzing methodological differences and biological context, researchers can resolve apparent contradictions and develop a more complete understanding of ATL3 function.

What are the optimal expression and purification methods for recombinant ATL3?

For successful recombinant ATL3 production, consider these optimized methods:

  • Expression system selection:

    • Bacterial systems (E. coli): Higher yield but may have folding issues for membrane proteins

    • Insect cell systems (Sf9, High Five): Better for complex proteins with post-translational modifications

    • Mammalian cells: Most native-like protein but typically lower yields

  • Construct design considerations:

    • Full-length vs. truncated constructs (consider experimental goals)

    • Fusion tags for purification (His, GST, MBP)

    • Codon optimization for expression system

    • Signal sequences if needed for membrane targeting

  • Purification strategy for full-length ATL3:

    • Membrane isolation from expression system

    • Detergent solubilization (DDM, CHAPS often effective for membrane proteins)

    • Affinity chromatography using fusion tag

    • Size exclusion chromatography as polishing step

    • Detergent exchange or reconstitution into liposomes for functional studies

  • Quality control parameters:

    • Purity assessment by SDS-PAGE

    • Functional validation through GTPase activity assays

    • Proper folding verification by circular dichroism

    • Homogeneity check by dynamic light scattering

Each step should be optimized based on the specific experimental requirements and downstream applications.

What controls are essential when designing experiments to study ATL3 function?

Proper controls are critical for reliable ATL3 research. Essential controls include:

  • For in vitro fusion assays:

    • Non-GTP control: Assay buffer without GTP to establish baseline activity

    • Maximum fusion control: Detergent addition (e.g., 0.5% Anapoe X-100) to determine complete mixing

    • Negative function controls: Catalytically inactive mutants (K73A, R217Q)

    • Protein-free liposomes: To control for spontaneous fusion

  • For GTPase activity assays:

    • No-protein control: To measure background phosphate

    • Time zero control: To establish starting conditions

    • Known concentration standards: For calibration curves

  • For cellular studies:

    • Empty vector controls: For transfection/transduction experiments

    • Wild-type rescue: In knockout/knockdown systems

    • Irrelevant protein controls: Proteins of similar size/localization but different function

    • Positive controls: Well-characterized ER markers or other atlastin paralogs

  • For mutational studies:

    • Conservative mutations: That shouldn't affect function

    • Known functional mutations: To validate assay sensitivity

    • Disease-associated mutations: Y192C and P338R for HSN

  • For statistical validity:

    • Biological replicates: Independent protein preparations or cell populations

    • Technical replicates: Multiple measurements of the same sample

    • Randomization: To minimize systematic biases

Implementing these controls ensures that experimental results are robust, reproducible, and correctly interpreted.

How should researchers report ATL3 experimental results in scientific publications?

For effective reporting of ATL3 research findings in scientific publications, adhere to these guidelines:

  • General structure for Results section:

    • Present findings in logical sequence without bias or interpretation

    • Break down data into sentences that show significance to research questions

    • Include all data corresponding to central research questions and secondary findings

  • Data presentation:

    • Present data in tables, charts, graphs, and other figures as appropriate

    • Provide contextual analysis explaining meaning in sentence form

    • Include numerical data with appropriate statistical measures

    • Use clear, informative figure legends

  • Statistical reporting:

    • Specify statistical tests used with justification

    • Report exact p-values rather than thresholds (e.g., p=0.023 rather than p<0.05)

    • Include measures of effect size where appropriate

    • Present confidence intervals for key measurements

  • Specific considerations for ATL3 fusion data:

    • Report full time courses where possible

    • Present fusion curves with clear indication of initial rates

    • When comparing multiple conditions, use consistent y-axis scales

    • Include both raw data and normalized results when appropriate

  • Image data for cellular studies:

    • Include representative images with scale bars

    • Show multiple fields/cells to demonstrate reproducibility

    • Use appropriate quantification methods for ER morphology

    • Provide both qualitative images and quantitative analysis

  • Methodology transparency:

    • Provide detailed protocols or reference to previous methods

    • Specify exact construct boundaries for recombinant proteins

    • Include protein and lipid concentrations for in vitro assays

    • Document reagent sources and validation

Following these reporting guidelines ensures that research findings are presented clearly, comprehensively, and in a manner that facilitates reproduction by other researchers.

How does ATL3 research contribute to understanding neurological disorders?

ATL3 research provides significant insights into neurological disorders through several mechanisms:

  • Direct disease connections:

    • Mutations in ATL3 (Y192C, P338R) cause Hereditary Sensory Neuropathy (HSN)

    • These mutations weaken the ATL3 soluble domain crossover dimer

    • Functional studies of these mutations reveal how ER fusion defects lead to neuropathy

  • Molecular mechanisms of pathogenesis:

    • HSN-associated mutations disrupt ATL3's interaction with GABARAP proteins, affecting ER-autophagy

    • Altered ER network structure affects neuronal development and function

    • Defective membrane fusion may particularly impact the extensive ER networks in neurons

  • Comparative insights with other atlastins:

    • ATL1 mutations cause Hereditary Spastic Paraplegia (HSP)

    • Comparing ATL1 and ATL3 mutation effects helps explain paralog-specific disease manifestations

    • Understanding why mutations in different atlastins affect distinct neuronal populations

  • Therapeutic implications:

    • Potential for small molecules that modulate ATL3 activity

    • Gene therapy approaches targeting ATL3 or compensatory pathways

    • Development of biomarkers for disease progression or therapeutic response

As research continues, ATL3 studies will likely contribute to developing targeted therapies for HSN and potentially provide insights into other neurological disorders involving ER dysfunction.

What are emerging research directions for ATL3 beyond membrane fusion?

Beyond its established role in ER membrane fusion, several promising research directions for ATL3 are emerging:

  • ATL3 in autophagy regulation:

    • Exploring ATL3's role as an ER-autophagy receptor through GABARAP interactions

    • Investigating connections between ATL3 and selective vs. nonselective autophagy

    • Understanding how ATL3 contributes to ULK1 and ATG13 signaling pathways

  • Viral interactions:

    • Characterizing ATL3's involvement in flavivirus replication through interactions with viral proteins

    • Determining whether ATL3 represents a potential target for antiviral therapies

    • Investigating how viruses exploit ER remodeling for replication

  • Protein trafficking roles:

    • Further exploring ATL3's contribution to protein export from the ER

    • Investigating mechanisms by which ATL3 influences protein targeting to the inner nuclear membrane

    • Determining if ATL3 plays direct or indirect roles in these processes

  • Stress response pathways:

    • Examining ATL3's role in ER stress responses

    • Investigating potential connections to the unfolded protein response

    • Exploring how constitutive fusion activity of ATL3 contributes to cellular resilience

  • Cell-type specific functions:

    • Mapping ATL3 expression and function across different tissues and cell types

    • Identifying cell populations particularly dependent on ATL3 function

    • Understanding why sensory neurons are especially vulnerable to ATL3 mutations

These emerging research directions highlight ATL3's multifaceted roles in cellular homeostasis and suggest potential new therapeutic targets for diseases involving ATL3 dysfunction.

How can evolutionary analysis of ATL3 inform research strategies?

Evolutionary analysis of ATL3 provides valuable insights that can guide research strategies:

  • Phylogenetic findings and implications:

    • ATL3 lacks C-terminal autoinhibition, similar to the invertebrate Drosophila ATL ortholog

    • C-terminal autoinhibition appears to be a recent evolutionary innovation in vertebrates

    • This evolutionary pattern suggests ATL3 represents the ancestral, constitutive fusion mechanism

  • Research strategies based on evolutionary insights:

    • Comparative studies of ATL3 orthologs across species can reveal conserved functional domains

    • Investigation of when and how autoinhibition evolved in ATL1/2 can illuminate regulatory mechanisms

    • Cross-species complementation experiments to test functional conservation

  • Model organism selection:

    • Drosophila models may be particularly relevant for basic ATL3 function studies

    • Vertebrate models needed to study the interplay between constitutive (ATL3) and regulated (ATL1/2) fusion

    • Species-specific differences in ER structure may inform cellular context requirements

  • Domain-focused approaches:

    • Structural analysis focused on evolutionarily conserved regions

    • Identification of species-specific domains that may confer specialized functions

    • Creation of chimeric proteins with domains from different species or paralogs

  • Therapeutic implications:

    • Evolutionary conservation can help predict which domains are essential vs. modifiable

    • Species differences may explain varied responses to potential therapeutic interventions

    • Ancient, conserved mechanisms may represent more robust therapeutic targets

By integrating evolutionary perspectives, researchers can develop more targeted approaches to understanding ATL3 function and potentially identify novel therapeutic strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.