Recombinant Human ATP-binding cassette sub-family B member 10, mitochondrial (ABCB10)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will accommodate your request.
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ABCB10; ATP-binding cassette sub-family B member 10, mitochondrial; ABC-mitochondrial erythroid protein; ABC-me protein; ATP-binding cassette transporter 10; ABC transporter 10 protein; Mitochondrial ATP-binding cassette 2; M-ABC2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
106-738
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
ABCB10
Target Protein Sequence
AGPGAPRLPRARFPGGPAAAAWAGDEAWRRGPAAPPGDKGRLRPAAAGLPEARKLLGLAY
PERRRLAAAVGFLTMSSVISMSAPFFLGKIIDVIYTNPTVDYSDNLTRLCLGLSAVFLCG
AAANAIRVYLMQTSGQRIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTALLGRS
VTENLSDGLRAGAQASVGISMMFFVSPNLATFVLSVVPPVSIIAVIYGRYLRKLTKVTQD
SLAQATQLAEERIGNVRTVRAFGKEMTEIEKYASKVDHVMQLARKEAFARAGFFGATGLS
GNLIVLSVLYKGGLLMGSAHMTVGELSSFLMYAFWVGISIGGLSSFYSELMKGLGAGGRL
WELLEREPKLPFNEGVILNEKSFQGALEFKNVHFAYPARPEVPIFQDFSLSIPSGSVTAL
VGPSGSGKSTVLSLLLRLYDPASGTISLDGHDIRQLNPVWLRSKIGTVSQEPILFSCSIA
ENIAYGADDPSSVTAEEIQRVAEVANAVAFIRNFPQGFNTVVGEKGVLLSGGQKQRIAIA
RALLKNPKILLLDEATSALDAENEYLVQEALDRLMDGRTVLVIAHRLSTIKNANMVAVLD
QGKITEYGKHEELLSKPNGIYRKLMNKQSFISA
Uniprot No.
Target Background
Function
ABCB10, also known as ATP-binding cassette sub-family B member 10, is a mitochondrial transporter protein. It catalyzes the ATP-dependent export of an unidentified physiological substrate from the mitochondrial matrix to the cytosol. ABCB10 might also transport the heme analog Zn (II) mesoporphyrin (ZnMP) in an ATP-dependent manner but cannot export the heme precursor 5-aminolevulinic acid (ALA) from mitochondria. It plays a crucial role in the early stages of heme biosynthesis by facilitating the insertion of iron into protoporphyrin IX (PPIX). This process is integral to hemoglobin synthesis and also provides protection against oxidative stress. Additionally, ABCB10 may be involved in the mitochondrial unfolded protein response (UPRmt) signaling pathway, although it is unlikely to directly participate in peptide export from mitochondria.
Gene References Into Functions
- Studies indicate that silencing ABCB10 leads to alterations in the heme biosynthesis transcriptional profile due to repression by the transcriptional regulator BACH1. (ABCB10 = ATP-binding cassette, sub-family B [MDR-TAP], member 10; BACH1 = BTB and CNC homology 1, basic leucine zipper transcription factor 1) PMID: 28808058
- ABCB10 is implicated in the unfolded protein response signaling pathway, although it likely does not directly participate in peptide export from mitochondria. PMID: 28315685
- ABCB10 is essential for primitive erythropoiesis and protects against oxidative stress associated with cardiac ischemia-reperfusion in mice. Antioxidants can mitigate the defects associated with ABCB10 loss-of-function in mice. PMID: 22884976
- ABCB10 is not a heme exporter but is required for the early mitochondrial steps of heme biosynthesis. PMID: 23720443
- Data suggest that ABCB10 might exist in an open-inwards conformation when nucleotide is bound. PMID: 23716676
- Human mitochondrial ATP-binding cassette transporter ABCB10 is crucial for efficient red blood cell development. PMID: 22085049
- Studies have investigated the targeting, import, and dimerization of ABCB10. PMID: 15215243
Database Links
Protein Families
ABC transporter superfamily, ABCB family, Mitochondrial peptide exporter (TC 3.A.1.212) subfamily
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitous. Highly expressed in bone marrow, expressed at intermediate to high levels in skeletal muscle, small intestine, thyroid, heart, brain, placenta, liver, pancreas, prostate, testis, ovary, leukocyte, stomach, spinal cord, lymph node, trachea and
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
