Recombinant Human ATP-binding cassette sub-family D member 4 (ABCD4)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

ABCD4 is a lysosomal ATP-binding cassette (ABC) transporter responsible for exporting vitamin B12 (cobalamin) from lysosomes to the cytosol . It functions as a homodimer, requiring ATP hydrolysis to transport cobalamin across membranes . Mutations in ABCD4 cause methylmalonic aciduria and homocystinuria (cblJ type), highlighting its clinical significance .

Production and Purification

Recombinant ABCD4 is typically expressed in mammalian or yeast systems for functional studies:

  • Expression Systems:

    • HEK293T cells: Yields >50 µg/mL with C-Myc/DDK tags .

    • Komagataella phaffii (yeast): Enables high-purity isolation for ATPase assays .

  • Purification:

    • Affinity chromatography (e.g., His-tag) .

    • Purity >80% confirmed via SDS-PAGE and Coomassie staining .

Table 2: Recombinant ABCD4 Production Parameters

ParameterHEK293T K. phaffii
TagC-Myc/DDKHis-tag
Concentration>50 µg/mLNot specified
Storage-80°C in PBS/glycerol-80°C in detergent

Functional Assays

Key findings from transport and ATPase activity studies:

  • ATPase Activity: ABCD4 hydrolyzes ATP at a rate of 15–20 nmol Pi/min/mg protein .

  • Cobalamin Transport:

    • Proteoliposomes reconstituted with ABCD4 export cobalamin in an ATP-dependent manner .

    • Mutations (e.g., K427A in Walker A) abolish both ATPase and transport functions .

Table 3: Functional Properties of ABCD4

PropertyWildtype ABCD4K427A Mutant
ATPase Activity18 nmol Pi/min/mg Undetectable
Cobalamin TransportYes No
Lysosomal LocalizationRequires LMBD1 Disrupted

Clinical and Mutational Insights

Pathogenic mutations (e.g., p.Arg432Gln, p.Asn141Lys) impair ABCD4-LMBD1 interaction or ATPase activity :

  • p.Asn141Lys: Retains ATPase activity but disrupts transport .

  • p.Tyr319Cys: Abolishes ATPase and transport functions .

  • Co-expression with LMBD1: Restores lysosomal targeting and rescues cobalamin processing in patient fibroblasts .

Research Applications

Recombinant ABCD4 is utilized for:

  • Mechanistic Studies: Elucidating transport kinetics via proteoliposome assays .

  • Drug Screening: Identifying modulators of cobalamin metabolism .

  • Structural Biology: Cryo-EM analysis of transport cycles .

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format currently in stock, we are happy to accommodate specific format requirements. Please indicate any preferences when placing your order, and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing should be avoided. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the intrinsic stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please communicate it to us, and we will prioritize development of the specified tag.
Synonyms
ABCD4; PXMP1L; Lysosomal cobalamin transporter ABCD4; ATP-binding cassette sub-family D member 4; PMP70-related protein; P70R; Peroxisomal membrane protein 1-like; PXMP1-L; Peroxisomal membrane protein 69; PMP69
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-606
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
ABCD4
Target Protein Sequence
MAVAGPAPGAGARPRLDLQFLQRFLQILKVLFPSWSSQNALMFLTLLCLTLLEQFVIYQV GLIPSQYYGVLGNKDLEGFKTLTFLAVMLIVLNSTLKSFDQFTCNLLYVSWRKDLTEHLH RLYFRGRAYYTLNVLRDDIDNPDQRISQDVERFCRQLSSMASKLIISPFTLVYYTYQCFQ STGWLGPVSIFGYFILGTVVNKTLMGPIVMKLVHQEKLEGDFRFKHMQIRVNAEPAAFYR AGHVEHMRTDRRLQRLLQTQRELMSKELWLYIGINTFDYLGSILSYVVIAIPIFSGVYGD LSPAELSTLVSKNAFVCIYLISCFTQLIDLSTTLSDVAGYTHRIGQLRETLLDMSLKSQD CEILGESEWGLDTPPGWPAAEPADTAFLLERVSISAPSSDKPLIKDLSLKISEGQSLLIT GNTGTGKTSLLRVLGGLWTSTRGSVQMLTDFGPHGVLFLPQKPFFTDGTLREQVIYPLKE VYPDSGSADDERILRFLELAGLSNLVARTEGLDQQVDWNWYDVLSPGEMQRLSFARLFYL QPKYAVLDEATSALTEEVESELYRIGQQLGMTFISVGHRQSLEKFHSLVLKLCGGGRWEL MRIKVE
Uniprot No.

Target Background

Function
ABCD4, an ATP-binding cassette transporter, plays a crucial role in transporting cobalamin (vitamin B12) from the lysosomal lumen to the cytosol. This transport process is ATP-dependent. ABCD4 is targeted to the lysosomal membrane by the LMBRD1 lysosomal chaperone from the endoplasmic reticulum. Upon reaching the lysosomal membrane, it forms a complex with the lysosomal chaperone LMBRD1 and the cytosolic MMACHC, facilitating the transport of cobalamin across the lysosomal membrane.
Gene References Into Functions
  1. Endogenous ABCD4 was found in both lysosomes and the endoplasmic reticulum (ER). Notably, its lysosomal localization was disrupted when LMBRD1 was knocked out. PMID: 27456980
  2. Research indicates that ABCD4's lysosomal targeting is dependent on co-expression and interaction with LMBRD1. Mutations in LMBRD1 and ABCD4, leading to cobalamin metabolism disorders cblF and cblJ (or mutations within the ATPase domain), disrupt the interactions between LMBRD1 and ABCD4. (LMBRD1 = nuclear export signal-interacting protein; ABCD4 = ATP-binding cassette, sub-family D (ALD), member 4) PMID: 28572511
  3. Findings suggest a model where membrane-bound LMBD1 and ABCD4 facilitate the directional delivery of lysosomal vitamin B12 to cytoplasmic MMACHC. PMID: 25535791
  4. Mutations affecting the putative ATPase domain of ABCD4 impact its function, indicating that the ATPase activity of ABCD4 might be involved in intracellular vitamin B12 processing. PMID: 22922874
  5. Defects in ABCB4 have been linked to progressive familial intrahepatic cholestasis type 3. PMID: 21514256
  6. Expression levels tend to be correlated with the severity of X-linked adrenoleukodystrophy PMID: 15800013

Show More

Hide All

Database Links

HGNC: 68

OMIM: 603214

KEGG: hsa:5826

STRING: 9606.ENSP00000349396

UniGene: Hs.94395

Involvement In Disease
Methylmalonic aciduria and homocystinuria type cblJ (MAHCJ)
Protein Families
ABC transporter superfamily, ABCD family, Peroxisomal fatty acyl CoA transporter (TC 3.A.1.203) subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitous.

Q&A

What is the basic structure and subcellular localization of human ABCD4?

ABCD4 (ATP Binding Cassette Subfamily D Member 4) is a half-transporter protein that requires dimerization to form a functional unit. Unlike other ABCD family members that localize to peroxisomes, ABCD4 is primarily a lysosomal membrane protein. The protein contains characteristic ATP-binding domains necessary for its transport function. ABCD4 possesses ATP hydrolysis activity and functions as an ATPase-coupled transmembrane transporter .

The protein is encoded by the ABCD4 gene located on chromosome 14 and is identified by several database identifiers including HGNC: 68, NCBI Gene: 5826, and UniProtKB/Swiss-Prot: O14678 . Current evidence suggests that while ABCD1, ABCD2, and ABCD3 are peroxisomal transporters, ABCD4 diverged functionally through evolutionary specialization for lysosomal localization.

What is the primary physiological role of ABCD4 in human cells?

ABCD4 functions as a lysosomal membrane protein that transports cobalamin (Vitamin B12) from the lysosomal lumen to the cytosol in an ATP-dependent manner . The protein is targeted from the endoplasmic reticulum to the lysosomal membrane by the LMBRD1 lysosomal chaperone. Once at the lysosomal membrane, ABCD4 forms a complex with LMBRD1 and cytosolic MMACHC to facilitate cobalamin transport across the lysosomal membrane .

This transport mechanism is essential for intracellular cobalamin processing and subsequent metabolism. ABCD4 plays a critical role in the cellular pathways involving cobalamin, particularly in the metabolism of water-soluble vitamins and cofactors. Disruption of ABCD4 function results in impaired cobalamin transport, leading to methylmalonic aciduria and homocystinuria, indicating its essential role in human metabolism .

How does ABCD4 compare structurally and functionally to other ABCD family members?

While ABCD4 belongs to the same subfamily as ABCD1, ABCD2, and ABCD3, it demonstrates distinct localization and functional properties. Other ABCD proteins are primarily peroxisomal transporters involved in fatty acid metabolism. ABCD1 and ABCD2, for example, function as peroxisomal transporters of fatty acyl-CoAs with both distinct and overlapping substrate specificities .

What disease mechanisms are associated with ABCD4 dysfunction?

ABCD4 dysfunction is primarily associated with methylmalonic aciduria and homocystinuria, specifically the cblJ and cblC types . These disorders result from impaired intracellular cobalamin metabolism due to defective lysosomal export of cobalamin.

The pathophysiological mechanism involves:

  • Failure to transport cobalamin from lysosomes to the cytosol

  • Subsequent deficiency in cytosolic cobalamin availability

  • Impaired activity of cobalamin-dependent enzymes: methionine synthase and methylmalonyl-CoA mutase

  • Accumulation of methylmalonic acid and homocysteine

  • Decreased methionine synthesis

These biochemical abnormalities lead to clinical manifestations including developmental delay, megaloblastic anemia, neurological deterioration, and metabolic acidosis. The molecular understanding of ABCD4's role in these disorders has enabled targeted diagnostic approaches through genetic testing and potential therapeutic strategies aimed at bypassing the defective transport mechanism .

How do oligomeric states influence ABCD4 transporter function?

While direct evidence for ABCD4 oligomeric states is limited in the provided search results, insights can be drawn from studies of other ABCD family members. ABCD1 and ABCD2 have been shown to form mainly tetramers rather than simple dimers . This suggests that ABCD4 might similarly exist in higher-order oligomeric assemblies.

Research on ABCD1 and ABCD2 demonstrated that:

  • These transporters form both homotetramers and heterotetramers

  • The tetrameric assemblies remain stable during the catalytic cycle

  • ATP binding influences the extraction efficiency of these proteins from membranes

If ABCD4 follows similar patterns, its oligomeric state may significantly impact its transport efficiency and substrate specificity. The potential formation of homo- or hetero-oligomers with other proteins could regulate its function in cobalamin transport. Understanding these oligomeric states could be crucial for developing strategies to modulate ABCD4 activity in disease conditions .

What are the molecular mechanisms of ATP-dependent cobalamin transport by ABCD4?

ABCD4 utilizes ATP hydrolysis to drive the transport of cobalamin across the lysosomal membrane. While specific details of ABCD4's transport cycle aren't fully detailed in the search results, insights from related ABC transporters suggest a mechanism involving:

  • ATP binding to the nucleotide-binding domains

  • Conformational changes in the transmembrane domains

  • Creation of a transport pathway for cobalamin

  • ATP hydrolysis driving the directional movement of substrate

  • Release of ADP and return to the resting state

The formation of a complex with LMBRD1 and MMACHC is critical for this process, suggesting a coordinated multi-protein transport mechanism . LMBRD1 serves as a lysosomal chaperone that targets ABCD4 to lysosomes and likely assists in substrate recognition or transport. MMACHC, a cytosolic protein, may function to accept cobalamin as it emerges from the lysosome, facilitating its subsequent processing in the cytosol.

What are effective approaches for expressing and purifying recombinant human ABCD4?

Based on studies with related ABCD proteins, effective approaches for ABCD4 expression and purification would likely include:

  • Expression Systems:

    • Mammalian cell lines (HEK293, CHO) for proper post-translational modifications

    • Baculovirus-insect cell systems for higher yield of functional membrane proteins

    • Specialized E. coli strains designed for membrane protein expression

  • Construct Design:

    • Addition of purification tags (His, FLAG, or GFP) at the C-terminus to avoid interference with targeting signals

    • Fusion with stabilizing proteins (e.g., GFP) to monitor expression and folding

    • Generation of chimeric constructs to study specific domains

  • Solubilization and Purification:

    • Use of mild detergents like α-DDM or β-DDM for extraction

    • ATP pretreatment to enhance extraction efficiency (as observed with ABCD1/2)

    • Affinity chromatography followed by size exclusion chromatography

    • Reconstitution into liposomes or nanodiscs for functional studies

For optimal results, researchers should consider that ATP preincubation significantly increases the solubilization efficiency of ABCD transporters from membranes, as demonstrated with ABCD1 and ABCD2 (extraction increased from approximately 10-15% to 45-65%) .

What analytical techniques are most informative for studying ABCD4 oligomeric states?

Based on successful approaches with related ABCD transporters, the following techniques would be most informative for studying ABCD4 oligomeric states:

  • Velocity Sucrose Gradient Centrifugation:

    • Allows separation of different oligomeric states based on size

    • Requires careful selection of detergents (C4C8 for monomers/dimers, Triton X-100 or DDM for higher assemblies)

  • Co-immunoprecipitation Assays:

    • Particularly effective when combined with differentially tagged versions of ABCD4

    • Can detect specific interactions between different forms of the protein

    • Successfully used to detect homo- and heterotetramers of ABCD1 and ABCD2

  • Native PAGE:

    • Allows visualization of intact complexes

    • May require adaptation for basic proteins like ABC transporters

    • The Deriphat-PAGE system has been successfully applied to ABC transporters

    • Histidine can replace glycine in the cathode buffer to improve focusing of basic proteins

  • Chimeric Protein Approaches:

    • Creation of covalently linked dimers to study tetramer formation

    • Differential tagging to distinguish between different oligomeric assemblies

    • Successfully demonstrated tetrameric assembly of ABCD1 and ABCD2

When implementing these techniques, researchers should note that preincubation with ATP significantly enhances the extraction efficiency of ABCD transporters, which can be critical for studying their native oligomeric states .

How can functional transport assays be established for ABCD4?

Establishing functional transport assays for ABCD4 would require approaches that measure the ATP-dependent movement of cobalamin across membranes. Based on knowledge of ABC transporters and ABCD4's function, effective assay approaches could include:

  • Vesicular Transport Assays:

    • Preparation of proteoliposomes containing purified ABCD4

    • Loading vesicles with radioactively labeled cobalamin (e.g., [57Co]cobalamin)

    • Measuring ATP-dependent uptake or efflux of labeled cobalamin

    • Analysis of transport kinetics with varying ATP and substrate concentrations

  • Cellular Transport Systems:

    • Creation of cell lines with controllable ABCD4 expression

    • Development of lysosomal cobalamin accumulation assays

    • Measurement of cobalamin export using fluorescently labeled analogs

    • Complementation assays in ABCD4-deficient cells from patients

  • ATPase Activity Assays:

    • Measurement of ATP hydrolysis rates as an indicator of transport activity

    • Correlation of ATPase activity with cobalamin binding and transport

    • Investigation of factors affecting coupling between ATP hydrolysis and transport

  • Fluorescence-based Approaches:

    • Development of FRET-based sensors to detect conformational changes during transport

    • Use of environment-sensitive fluorophores to track substrate movement

    • Real-time monitoring of transport in reconstituted systems

These methodologies can be adapted from approaches successfully used with other ABC transporters, with specific modifications to account for ABCD4's lysosomal localization and cobalamin substrate.

How does ABCD4 interact with LMBRD1 and MMACHC to facilitate cobalamin transport?

ABCD4 forms a functional complex with LMBRD1 and MMACHC to facilitate cobalamin transport from lysosomes to the cytosol. The process involves several coordinated steps:

  • LMBRD1, a lysosomal membrane protein, functions as a chaperone that targets ABCD4 from the endoplasmic reticulum to the lysosomal membrane .

  • Once at the lysosomal membrane, ABCD4 forms a complex with LMBRD1 that serves as the core transport machinery for cobalamin.

  • The cytosolic protein MMACHC interacts with this complex, likely serving as an acceptor for cobalamin as it emerges from the lysosome .

  • ABCD4 utilizes ATP hydrolysis to drive the transport of cobalamin across the lysosomal membrane.

  • Upon reaching the cytosol, cobalamin can be processed by MMACHC and other enzymes for incorporation into methylcobalamin and adenosylcobalamin, the active forms of vitamin B12.

This multi-protein complex ensures the efficient transport and processing of cobalamin, highlighting the sophisticated coordination required for vitamin B12 metabolism. Disruption of any component of this complex can lead to impaired cobalamin transport and subsequent metabolic disorders .

What structural features determine ABCD4's substrate specificity for cobalamin versus other potential substrates?

While the search results don't provide specific details about ABCD4's substrate-binding domains, insights can be drawn from its function and related transporters:

ABCD4's specialization for cobalamin transport, in contrast to the fatty acid transport function of other ABCD family members, suggests unique structural adaptations. These likely include:

  • Substrate Binding Pocket: ABCD4 likely possesses a binding pocket appropriately sized and charged to accommodate the complex structure of cobalamin, which is significantly different from fatty acids transported by other ABCD proteins.

  • Transmembrane Domains: The arrangement of transmembrane helices would create a pathway suitable for the larger cobalamin molecule, possibly with specific residues that interact with cobalamin's corrin ring, nucleotide moiety, or cobalt center.

  • Interaction Interfaces: ABCD4's ability to interact with LMBRD1 and MMACHC suggests the presence of specific protein-protein interaction surfaces that contribute to substrate specificity by creating a coordinated transport channel.

  • Oligomeric Organization: If ABCD4 forms tetramers like other ABCD transporters , this higher-order organization could create a central pore or transport pathway specifically configured for cobalamin transport.

Further structural studies, particularly X-ray crystallography or cryo-electron microscopy of ABCD4 alone or in complex with its interacting partners, would be necessary to fully elucidate these features.

How can recombinant ABCD4 be utilized in drug discovery for methylmalonic aciduria and homocystinuria?

Recombinant ABCD4 provides valuable tools for drug discovery efforts targeting methylmalonic aciduria and homocystinuria. Strategic approaches include:

  • High-throughput Screening Platforms:

    • Development of assays using purified ABCD4 to screen for compounds that enhance cobalamin transport

    • Cell-based assays in ABCD4-deficient patient cells to identify molecules that bypass or correct transport defects

    • Screening for compounds that stabilize mutant ABCD4 proteins and rescue their function

  • Structure-based Drug Design:

    • Using structural information about ABCD4 to design molecules that can modulate its activity

    • Development of allosteric modulators that could enhance the function of partially active mutant proteins

    • Design of small molecules that mimic ABCD4's interaction with LMBRD1 or MMACHC to promote complex formation

  • Gene Therapy Approaches:

    • Using knowledge of ABCD4 function to design optimal gene replacement strategies

    • Development of ABCD4 variants with enhanced stability or transport efficiency

    • Creation of chimeric proteins that might bypass defective transport mechanisms

  • Pharmacological Chaperone Development:

    • Identification of molecules that can stabilize misfolded ABCD4 mutants

    • Design of compounds that promote proper trafficking of ABCD4 to lysosomes

    • Development of molecules that facilitate ATP binding or hydrolysis in compromised ABCD4 variants

These approaches could lead to novel therapeutics that address the root cause of cobalamin-related disorders, potentially offering more effective treatment options than current vitamin B12 supplementation strategies.

What are the most promising techniques for investigating ABCD4's role in neurological development and disorders?

Given ABCD4's role in cobalamin transport and the neurological manifestations of related disorders, several advanced techniques show promise for elucidating its function in neural development:

  • Conditional Knockout Models:

    • Development of tissue-specific and temporally controlled ABCD4 knockout mice

    • Analysis of neurological phenotypes in models with neural-specific ABCD4 deficiency

    • Investigation of developmental windows where ABCD4 function is most critical

  • Advanced Neuroimaging:

    • Utilization of magnetic resonance imaging and spectroscopy to detect metabolic changes in ABCD4-deficient brains

    • Tracking of cobalamin distribution in neural tissues using labeled analogs

    • Correlation of imaging findings with cognitive and developmental assessments

  • Patient-derived Models:

    • Generation of induced pluripotent stem cells (iPSCs) from patients with ABCD4 mutations

    • Differentiation of iPSCs into neural cell types to study cell-specific effects

    • Creation of cerebral organoids to model three-dimensional brain development

  • Multi-omics Approaches:

    • Integration of transcriptomics, proteomics, and metabolomics to map ABCD4's influence on neural metabolic networks

    • Identification of biomarkers for early detection and therapeutic monitoring

    • Discovery of compensatory pathways that might be therapeutically exploited

These methodologies can provide comprehensive insights into ABCD4's role in neurological development and disease, potentially revealing new therapeutic targets and diagnostic approaches for related disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.