Recombinant Human ATP-binding cassette sub-family G member 1 (ABCG1)

Shipped with Ice Packs
In Stock

Description

Key Functional Roles

FunctionMechanismKey Findings
Cholesterol EffluxExports cholesterol to HDL, LDL, and phospholipid vesicles via ATP hydrolysisRequired for reverse cholesterol transport (RCT); loss impairs lipid clearance .
Phospholipid TransportTransports sphingomyelin and oxysterols (e.g., 7β-hydroxycholesterol)Prevents cytotoxic lipid accumulation in macrophages .
Apoptosis RegulationInduces phosphatidylserine translocation and caspase-3 activationOverexpression promotes macrophage apoptosis via LXR activation .

Recombinant ABCG1 Production and Applications

Recombinant ABCG1 is produced in diverse expression systems to enable functional and structural studies:

Expression SystemHost OrganismPurityApplications
Wheat GermIn vitro>85% (SDS-PAGE)ELISA, Western blot, and functional assays .
E. coliBacterial>95% (Chromatography)Structural studies, antibody generation, and protein-protein interaction assays .
Mammalian CellsHEK293, CHOVariableTrafficking and localization studies (e.g., plasma membrane vs. ER) .

Key Applications:

  • Cholesterol Efflux Assays: Recombinant ABCG1 is used to quantify efflux rates to HDL or cyclodextrin .

  • Antibody Development: Serves as an antigen for generating polyclonal/monoclonal antibodies for immunoblotting and immunohistochemistry .

  • Drug Target Screening: Tested with inhibitors (e.g., thyroxin, benzamil) to modulate efflux and apoptosis .

Functional Studies

Study TypeOutcomeImplication
Knockout ModelsMacrophage/hepatocyte lipid accumulation; reduced HDL cholesterol .ABCG1 is essential for tissue lipid homeostasis.
OverexpressionReduced atherosclerosis in rabbits; enhanced RCT .Therapeutic potential in cardiovascular diseases.
Apoptosis LinkABCG1 overexpression induces macrophage apoptosis via phosphatidylserine exposure .Dual role in cholesterol efflux and cell death regulation.

Molecular Mechanisms

  • LXR Activation: Cholesterol loading upregulates ABCG1 via Liver X Receptor (LXR) signaling, enhancing efflux .

  • Heterodimerization: ABCG1 forms homodimers or heterodimers (e.g., with ABCA1) to modulate efflux efficiency .

Clinical and Therapeutic Relevance

  • Atherosclerosis: ABCG1 deficiency in macrophages reduces atherosclerosis in LDLr−/− mice, highlighting its complex role .

  • Lipid Disorders: Variants in ABCG1 (e.g., g.-376C>T) associate with increased cardiovascular risk due to impaired efflux .

Table 1: Recombinant ABCG1 Products

SourceFormatPurityApplications
Abcam (ab153003)Wheat Germ>85%ELISA, Western blot
MyBioSourceE. coli>95%Antibody generation, IP assays
Cell-Free SystemsIn vitro~85%Structural studies (e.g., NMR, X-ray)

Table 2: Key Mutational Studies

MutationEffectReference
N316Q/F320IImpaired trafficking; reduced efflux
K124MLoss of ATPase activity; no apoptosis
N316D/N316QDisrupted membrane localization

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method or location. For specific delivery estimates, please contact your local distributors.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is required, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to settle the contents. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
ABCG1; ABC8; WHT1; ATP-binding cassette sub-family G member 1; ATP-binding cassette transporter 8; White protein homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-678
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MACLMAAFSVGTAMNASSYSAEMTEPKSVCVSVDEVVSSNMEATETDLLNGHLKKVDNNL TEAQRFSSLPRRAAVNIEFRDLSYSVPEGPWWRKKGYKTLLKGISGKFNSGELVAIMGPS GAGKSTLMNILAGYRETGMKGAVLINGLPRDLRCFRKVSCYIMQDDMLLPHLTVQEAMMV SAHLKLQEKDEGRREMVKEILTALGLLSCANTRTGSLSGGQRKRLAIALELVNNPPVMFF DEPTSGLDSASCFQVVSLMKGLAQGGRSIICTIHQPSAKLFELFDQLYVLSQGQCVYRGK VCNLVPYLRDLGLNCPTYHNPADFVMEVASGEYGDQNSRLVRAVREGMCDSDHKRDLGGD AEVNPFLWHRPSEEVKQTKRLKGLRKDSSSMEGCHSFSASCLTQFCILFKRTFLSIMRDS VLTHLRITSHIGIGLLIGLLYLGIGNEAKKVLSNSGFLFFSMLFLMFAALMPTVLTFPLE MGVFLREHLNYWYSLKAYYLAKTMADVPFQIMFPVAYCSIVYWMTSQPSDAVRFVLFAAL GTMTSLVAQSLGLLIGAASTSLQVATFVGPVTAIPVLLFSGFFVSFDTIPTYLQWMSYIS YVRYGFEGVILSIYGLDREDLHCDIDETCHFQKSEAILRELDVENAKLYLDFIVLGIFFI SLRLIAYFVLRYKIRAER
Uniprot No.

Target Background

Function
ABCG1 catalyzes the efflux of phospholipids such as sphingomyelin, cholesterol, and its oxygenated derivatives, including 7beta-hydroxycholesterol. This transport mechanism is coupled to the hydrolysis of ATP. The lipid efflux is albumin-dependent. ABCG1 serves as an active component of the macrophage lipid export complex. It may also participate in intracellular lipid transport processes. Its role in cellular lipid homeostasis might extend beyond macrophages. ABCG1 prevents cell death by transporting cytotoxic 7beta-hydroxycholesterol.
Gene References Into Functions
  1. HSP70 inhibits the expression of ABCA1 and ABCG1 by preventing Elk-1 from binding to the promoter of ABCA1 and ABCG1 in human THP-1-derived macrophages. PMID: 29678642
  2. Downregulation of ABCG1 in macrophages promotes the development of atherosclerotic lesions. PMID: 30393020
  3. High ABCG1 expression is associated with glioma. PMID: 26981778
  4. ABCG1 regulates pulmonary surfactant metabolism PMID: 28264879
  5. Hepatic free cholesterol content is significantly elevated in NASH compared to non-NASH subjects, while ABCA1 and ABCG1 protein levels are significantly reduced with NASH and fibrosis progression. The relative expression of miR-33a and miR-144 inversely correlates with ABCA1 but not with ABCG1 protein levels. miR-33a/144 and their target gene ABCA1 might contribute to the pathogenesis of NASH in morbidly obese subjects. PMID: 26945479
  6. Understanding the interplay between cholesterol and inflammation in the lung, and the role of ABC transporters in this process, may illuminate new therapeutic targets for inflammatory lung diseases. PMID: 28241820
  7. Findings suggest that ABCG1-mediated efflux of cholesterol, but not of 7-ketocholesterol, exhibits specificity for structural domains of apoA-I bound to reconstituted HDL. While the mid region alone of apoA-I associated with rHDL can promote ABCG1-mediated cholesterol efflux, deletion of the carboxyl-terminal region 185-243 from full-length apoA-I diminishes ABCG1-mediated cholesterol efflux. PMID: 23826352
  8. ABCG1 regulates T cell differentiation into Tregs, highlighting a pathway by which cholesterol accumulation can influence T cell homeostasis in atherosclerosis. PMID: 27482882
  9. ABCG1 and ABCG4 alter the distribution of gamma-secretase on the plasma membrane, leading to reduced gamma-secretase activity and suppressed Abeta secretion. PMID: 27196068
  10. Both the full-length and short isoforms of ABCG1 can dimerize with ABCG4, while the ABCG2 multidrug transporter is incapable of forming a heterodimer with ABCG4. PMID: 27228027
  11. DNA methylation at the ABCG1 locus cg06500161 in blood DNA is associated with an increased risk of developing type 2 diabetes. PMID: 27148772
  12. We have newly identified a haplotype-tagging SNP, rs225396, in ABCG1 to be associated with PCV and nAMD in Chinese and Japanese cohorts. This provides further evidence to support ABCG1 as a susceptibility gene for PCV and nAMD. PMID: 27787563
  13. ABCG1 gene expression exhibits a positive correlation with obesity indicators. PMID: 27420620
  14. Our findings indicate that genetic variants of ABCG1 may be predictive of survival rates in nonsmall-cell lung cancer patients. PMID: 26757251
  15. This review focuses on the role of ABC transporters A1 and G1 in the pathogenesis of atherosclerosis. PMID: 27239842
  16. Leu at position 550/562 in mABCG1/hABCG1 is crucial for their plasma membrane localization but not for ABCG1-mediated cholesterol efflux. PMID: 26695502
  17. ABCG1 polymorphisms are associated with a reduced risk of developing ischemic stroke in hypertriglyceridemic populations and atherothrombotic stroke in a cohort of Chinese Han population. PMID: 25890853
  18. Data suggest that ligand-induced activation of RAGE (advanced glycosylation end product-specific receptor) down-regulates ABCG1-mediated cholesterol efflux from macrophages, potentially contributing to diabetic angiopathies and atherosclerotic plaques. PMID: 26253613
  19. Propofol upregulates expression of ABCA1, ABCG1, and SR-B1 through the PPARgamma/LXRalpha pathway in THP-1 macrophage-derived foam cells. PMID: 25600616
  20. Expression analysis revealed an association between ABCG1 methylation and lipid levels, potentially mediated by ABCG1 expression. PMID: 25583993
  21. HUWE1 and NEDD4-1 are two E3 ligases that are fundamental enzymes in the post-translational regulation of ABCG1 and ABCG4 protein levels and cellular cholesterol export activity. PMID: 26296893
  22. These findings indicate that SNP rs1893590 of ABCG1 has a significant impact on HDL-C under asymptomatic clinical conditions in an age and BMI-dependent manner. PMID: 25398214
  23. ABCG1 promoter rs57137919G>A variant demonstrates an allele-specific effect on ABCG1 expression and is associated with increased apoptosis in cholesterol-loaded macrophages. PMID: 24972087
  24. This review summarizes the current knowledge and perspectives on the regulatory role of CAV1 on cholesterol homeostasis with emphasis on the association of CAV1 with ABCA1 and ABCG1. [review] PMID: 24801727
  25. Individuals with hyperalphalipoproteinemia exhibit a decrease in hsa-miR-33a and higher mRNA expression of ABCA1 and ABCG1. PMID: 26051418
  26. ABCG1 can interact with cholesterol through a functional CRAC domain (cholesterol recognition/interaction amino acid consensus motifs). PMID: 25732853
  27. Ang-(1-7) upregulates ABCA1 and ABCG1 expression. PMID: 25225013
  28. These results suggest that ABCA1, ABCG1, and ABCG4 are localized to distinct membrane meso-domains and disrupt the meso-domain structures by reorganizing lipids on the plasma membrane. PMID: 25302608
  29. The role of cellular cholesterol transport proteins, including adenosine triphosphate binding cassette transporter A1 (ABCA1), G1 (ABCG1), and scavenger receptor class B type I (SR-BI), in diabetic nephropathy was investigated. PMID: 25181357
  30. Promoter DNA hypermethylation of the ABCG1 and GALNT2 genes, but not the HMGCR gene, is associated with an increased risk of CHD. PMID: 25084356
  31. The study identifies a major role of adipocyte ABCG1 in adiposity and fat mass growth, suggesting that adipose ABCG1 might represent a potential therapeutic target for obesity. PMID: 25249572
  32. Knock-outs display an expansion of B-1 B cells, which secrete natural antibodies that protect against atherosclerosis. PMID: 25339664
  33. A decrease in ABCG1 gene expression in macrophages is associated with atherosclerosis. PMID: 25509420
  34. In human macrophages, polyunsaturated fatty acids such as EPA influence cholesterol homeostasis, affecting the expression of the ABCG1 gene. PMID: 24901717
  35. Generation of extracellular cholesterol microdomains is mediated by ABCG1. PMID: 24212237
  36. These findings indicate that CAV1 interacts with ABCG1 and regulates ABCG1-mediated cholesterol efflux. PMID: 24576892
  37. Data suggest that in placentas from women with pre-eclampsia, expression of ABCA1 (ABC transporter 1) is down-regulated in the apical membrane of villous syncytiotrophoblast and in villous fetal endothelial cells; expression of ABCG1 remains unchanged. PMID: 23880356
  38. Results suggest that a reduction in ABCG1 induces endothelial apoptosis, seemingly associated with intracellular free cholesterol accumulation and subsequent ER stress. PMID: 23897420
  39. Our results showed that CETP is a susceptibility gene for neovascular age-related macular degeneration and polypoidal choroidal vasculopathy (PCV), and ABCG1 is a putative gene for PCV. PMID: 24393350
  40. No significant associations were detected for the ABCB6 or ABCG1 gene. PMID: 24192121
  41. ABCA1 and ABCG1 ubiquitination and degradation are regulated by cellular cholesterol. PMID: 24500716
  42. MiR-128-2 directly inhibits the expression of ABCA1, ABCG1, and RXRalpha through a miR-128-2-binding site within their respective 3' untranslated regions. PMID: 23990020
  43. Two highly conserved residues, Asn and Phe, play a significant role in ABCG1-dependent export of cellular cholesterol through the regulation of ABCG1 trafficking. PMID: 24320932
  44. LXRalpha plays a central role in neopterin-induced downregulation of ABCA1 and ABCG1 in THP-1 macrophage-derived foam cells. PMID: 23564066
  45. Our data suggest that MCP-1 impairs RCT activity in HepG2 cells by a PI3K/Akt-mediated posttranslational regulation of ABCA1, ABCG1, and SR-BI cell-surface expression. PMID: 23402987
  46. Evidence is presented for the first time suggesting that resveratrol is able to activate ABCG1 activity through an alternative mechanism that involves an indirect interaction. PMID: 23770099
  47. Endothelial dysfunction induced by high glucose is associated with decreased ABCG1 expression. PMID: 22365996
  48. ABCG1 is an active lipid transporter and possesses distinct binding sites for cholesterol and sphingomyelin. PMID: 23172659
  49. Genetic variations in ABCA1 and ABCG1 were not associated with an increased risk of type 2 diabetes in the general population. PMID: 23139370
  50. These data indicate that ABCA1, ABCG1, and SR-BI are reduced in various populations under subclinically inflammatory conditions, potentially leading to impaired reverse cholesterol transport and the development of atherosclerosis. PMID: 22614118

Show More

Hide All

Database Links

HGNC: 73

OMIM: 603076

KEGG: hsa:9619

STRING: 9606.ENSP00000354995

UniGene: Hs.124649

Protein Families
ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Cell membrane. Note=Predominantly localized in the intracellular compartments mainly associated with the endoplasmic reticulum (ER) and Golgi membranes.
Tissue Specificity
Expressed in several tissues. Expressed in macrophages; expression is increased in macrophages from patients with Tangier disease.

Q&A

What is ABCG1 and what is its primary function in human cells?

ABCG1 (ATP-binding cassette sub-family G member 1) is a membrane transporter protein belonging to the superfamily of ATP-binding cassette (ABC) transporters. It is specifically a member of the White subfamily among the seven distinct ABC subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). The primary function of ABCG1 is to catalyze the efflux of phospholipids (including sphingomyelin) and cholesterol from cells in an ATP-dependent manner. This process is critical for maintaining cellular lipid homeostasis, particularly in macrophages where it helps prevent excessive lipid accumulation. ABCG1 also transports oxygenated derivatives of cholesterol, such as 7beta-hydroxycholesterol, which prevents cellular toxicity and death .

The protein functions as an active component of the macrophage lipid export complex, where its transport activity is coupled to ATP hydrolysis. This transport process is albumin (ALB)-dependent according to biochemical studies. Beyond macrophages, ABCG1 likely contributes to cellular lipid homeostasis in various cell types throughout the body .

How does ABCG1 differ from other ABC transporters in structure and function?

  • As a member of the White subfamily, ABCG1 has a specific structural arrangement and substrate specificity that distinguishes it from other ABC subfamilies.

  • Unlike some ABC transporters involved in drug efflux (like ABCB1), ABCG1 primarily transports endogenous lipids and sterols.

  • ABCG1 demonstrates specific binding to cholesterol, phospholipids, and certain glycoproteins, reflecting its specialized role in lipid metabolism .

The closest paralog to ABCG1 is ABCG4, which shares functional similarities in lipid transport . While both transporters mediate cholesterol efflux, they may have tissue-specific expression patterns and subtle differences in substrate preferences.

Unlike ABCB1 (another well-studied ABC transporter), ABCG1's polymorphisms have not been as extensively studied in relation to cancer therapeutic outcomes, suggesting different clinical relevance .

What expression systems are most effective for producing functional recombinant human ABCG1?

Multiple expression systems have been successfully used to produce recombinant ABCG1 with varying degrees of functionality and yield:

Expression SystemAdvantagesConsiderations
Mammalian Cells (HEK293)Native post-translational modifications, proper membrane insertionHigher cost, lower yield
Insect CellsHigher expression levels than mammalian cells, eukaryotic processingGlycosylation patterns differ from human
YeastCost-effective, high-yield eukaryotic systemMembrane composition differences may affect function
E. coliHighest yield, lowest costLacks post-translational modifications, inclusion body formation common
Cell-Free SystemsRapid production, avoids toxicity issuesTypically lower yield, may lack membrane environment

For functional studies requiring native-like activity, mammalian expression systems (particularly HEK293 cells) are often preferred as they provide the appropriate cellular machinery for correct folding and post-translational modifications of human ABCG1 . When studying protein-protein interactions or structural analyses, expression with epitope tags (GST, His, DDK, Myc) is commonly employed to facilitate purification and detection .

For researchers investigating specific domains or functions, wheat germ cell-free systems have also been successfully used to express ABCG1 fragments with preserved functional domains .

What are the critical factors in purifying functional recombinant ABCG1?

Purification of functional ABCG1 presents several challenges due to its membrane-embedded nature and dependence on lipid environment. Key considerations include:

  • Membrane extraction: Use of appropriate detergents (typically mild non-ionic detergents like DDM or LMNG) that maintain protein structure while efficiently solubilizing ABCG1 from membranes.

  • Lipid preservation: Supplementation with cholesterol and phospholipids during purification to maintain the native lipid environment necessary for ABCG1 function.

  • ATP binding site protection: Addition of nucleotides or nucleotide analogs during purification to stabilize the NBDs.

  • Affinity purification: Utilization of fusion tags (His, GST, DDK, or Myc) for efficient isolation of the target protein .

  • Quality control: Verification of oligomeric state (ABCG1 functions as a homodimer) and ATP binding capacity as indicators of properly folded protein.

Researchers should monitor protein activity throughout purification, as loss of transport function is common with aggressive purification protocols. Reconstitution into liposomes or nanodiscs is often required to restore and measure functional activity after purification.

What methodologies are most reliable for measuring ABCG1-mediated lipid transport activity?

Several methodologies have been developed to assess ABCG1-mediated lipid transport with varying degrees of physiological relevance:

  • Radiolabeled cholesterol efflux assays: Cells expressing ABCG1 are loaded with [³H]cholesterol, and efflux to acceptors like HDL or albumin is quantified by measuring radioactivity in media and cells.

  • Fluorescently labeled lipid transport: Using NBD-cholesterol or BODIPY-cholesterol to track transport activity in real-time via fluorescence microscopy or plate reader measurements.

  • Mass spectrometry-based approaches: Provides detailed analysis of specific lipid species transported by ABCG1, offering insights into substrate specificity.

  • ATPase activity assays: Measures ATP hydrolysis rates as an indirect indicator of transport activity, particularly useful for purified recombinant ABCG1.

  • Liposome reconstitution systems: Purified ABCG1 reconstituted into artificial liposomes allows direct measurement of transport across a defined membrane.

The choice of method depends on the specific research question. For drug screening or high-throughput approaches, fluorescence-based methods may be preferred. For detailed mechanistic studies, combining multiple approaches provides the most comprehensive assessment of ABCG1 function .

How can researchers distinguish between ABCG1-specific functions and those of other ABC transporters with overlapping activities?

Distinguishing ABCG1-specific functions requires strategic experimental approaches:

  • Genetic approaches:

    • CRISPR/Cas9-mediated ABCG1 knockout cells

    • siRNA or shRNA targeting ABCG1 specifically

    • Generation of cells expressing transport-deficient ABCG1 mutants (e.g., ATP-binding site mutations)

  • Pharmacological approaches:

    • Use of selective inhibitors (though truly selective ABCG1 inhibitors remain limited)

    • Combination of inhibitors with genetic approaches to confirm specificity

  • Substrate specificity analysis:

    • ABCG1 preferentially transports 7beta-hydroxycholesterol, which can serve as a relatively specific marker of its activity

    • Compare transport profiles with other ABC transporters (particularly ABCA1 and ABCG4)

  • Acceptor dependency:

    • ABCG1-mediated lipid efflux shows distinct dependencies on acceptors like albumin that differ from other transporters

Multiple complementary approaches should be employed simultaneously to build a convincing case for ABCG1-specific effects, particularly in complex cellular systems where multiple transporters are expressed.

How do post-translational modifications regulate ABCG1 function and stability?

ABCG1 undergoes several post-translational modifications that critically influence its trafficking, stability, and activity:

  • Glycosylation: N-linked glycosylation contributes to proper folding and membrane trafficking of ABCG1. Analysis of glycosylation-deficient mutants reveals impaired transport to the plasma membrane.

  • Phosphorylation: Multiple phosphorylation sites have been identified that regulate ABCG1 activity. Phosphorylation by protein kinases like PKA and PKC modulates transport activity and can serve as a rapid regulatory mechanism in response to cellular signaling.

  • Ubiquitination: Regulates ABCG1 protein stability and turnover. Increased ubiquitination leads to proteasomal degradation, providing a mechanism for downregulation of ABCG1 levels and activity.

  • Palmitoylation: Contributes to membrane microdomain localization, potentially affecting ABCG1's interaction with lipid rafts and access to substrate pools.

Researchers investigating post-translational modifications should employ site-directed mutagenesis of modification sites, specific inhibitors of modifying enzymes, and mass spectrometry techniques to comprehensively analyze how these modifications affect ABCG1 function in different cellular contexts .

What is known about the interactome of ABCG1 and how does it influence transporter function?

ABCG1 engages in multiple protein-protein interactions that influence its localization, stability, and transport function:

  • Homodimerization: ABCG1 functions primarily as a homodimer, with dimerization essential for transport activity. The protein homodimerization domain is critical for proper assembly and function .

  • Protein binding partners: ABCG1 interacts with numerous proteins including:

    • ATP6V1H, NFAT5, CEACAM21, E2F3, ATP10A, KIAA1191, LMO2, GTF2F2, SPINK2, and RAB1

    • These interactions may facilitate trafficking, regulation, or coupling to other cellular processes

  • Lipid-associated proteins: ABCG1 functionally interacts with:

    • Cholesterol binding proteins: OSBPL1A, OSBPL10, PMP2, SOAT1, APOEB, APOA2, CYP11A1, APOA1

    • Phospholipid binding proteins: NR5A2, NOXO1, SHC1, ABCA1, SPTBN1

The interaction network suggests ABCG1 functions within a larger complex of lipid metabolism proteins rather than as an isolated transporter. Proximity labeling approaches (BioID, APEX) combined with mass spectrometry have proven valuable in identifying transient or weak interactions within this network.

Research approaches to study these interactions include co-immunoprecipitation, FRET/BRET analyses, yeast two-hybrid screening, and in vitro binding assays with purified components. Cross-linking mass spectrometry can provide detailed information about interaction interfaces.

How does ABCG1 dysfunction contribute to atherosclerosis and other metabolic disorders?

ABCG1 plays a crucial role in preventing atherosclerosis and other metabolic disorders through its cholesterol efflux function:

  • Macrophage foam cell formation: ABCG1 deficiency leads to cholesterol accumulation in macrophages, promoting transformation into foam cells—a hallmark of atherosclerotic lesions. This suggests ABCG1 normally protects against plaque formation through efficient cholesterol removal.

  • Inflammatory signaling: Impaired ABCG1 function increases inflammatory cytokine production in macrophages, contributing to vascular inflammation.

  • Tissue-specific effects: Beyond macrophages, ABCG1 dysfunction in:

    • Pancreatic β-cells: Disrupts insulin secretion, contributing to diabetes progression

    • Adipocytes: Alters adipokine secretion, affecting systemic metabolism

    • Endothelial cells: Impairs nitric oxide production, affecting vascular function

  • Interaction with metabolic pathways: ABCG1 is involved in the "Plasma lipoprotein assembly, remodeling, and clearance" pathway and "NR1H2 and NR1H3-mediated signaling" pathways , connecting its function to broader lipid metabolism networks.

ABCG1 dysfunction has been associated with Tangier Disease and Sitosterolemia , indicating its importance in preventing pathological lipid accumulation. Research models employing tissue-specific ABCG1 knockout or transgenic overexpression have been valuable in delineating these pathophysiological roles.

What genetic variants of ABCG1 have been identified, and how do they affect protein function and disease risk?

While the search results don't provide extensive information on ABCG1 genetic variants specifically, we can draw parallels from studies of other ABC transporters:

  • Polymorphisms in ABC transporters, such as the rs2032582 variant in ABCB1 (another ABC family member), have been associated with disease outcomes in cancer and other conditions .

  • By analogy, genetic variants in ABCG1 likely affect:

    • Transport efficiency and substrate specificity

    • Protein stability and membrane localization

    • Regulation by cellular signaling pathways

    • Interaction with partner proteins

  • Research approaches to study ABCG1 variants:

    • Population-based association studies linking variants to disease phenotypes

    • Functional characterization using site-directed mutagenesis

    • Structural studies to understand how variants affect protein architecture

    • Cell-based transport assays to measure functional consequences

Researchers investigating ABCG1 variants should consider both common polymorphisms and rare variants, as both may contribute to disease phenotypes through different mechanisms. Whole-exome or targeted sequencing of ABCG1 in patient cohorts with lipid disorders, followed by functional validation, represents a productive research strategy.

What are essential controls and considerations for studying ABCG1 in cellular models?

When designing experiments to study ABCG1 function in cellular models, several controls and considerations are essential:

  • Expression level controls:

    • Western blotting to confirm ABCG1 expression levels

    • Comparison with physiologically relevant expression (e.g., in macrophages)

    • Use of inducible expression systems to avoid artifacts from overexpression

  • Localization verification:

    • Immunofluorescence or subcellular fractionation to confirm proper membrane localization

    • Assessment of glycosylation status as indicator of proper processing

  • Functional controls:

    • ATPase-defective mutants (K324M, K664M) to distinguish ATP-dependent from non-specific effects

    • Comparison with other transporters (ABCA1, ABCG4) to identify specific vs. general effects

    • Lipid-binding deficient mutants to confirm substrate specificity

  • Cell type considerations:

    • Choice of appropriate cell background (macrophages vs. HEK293)

    • Assessment of endogenous ABCG1 expression

    • Consideration of cell-specific factor dependencies

  • Substrate considerations:

    • Use of multiple substrate types (cholesterol, phospholipids, oxysterols)

    • Appropriate acceptors (albumin-dependence has been documented)

  • Technical replicates and biological replicates:

    • Independent cell preparations and experiments

    • Statistical power calculations to determine appropriate sample sizes

These controls help distinguish specific ABCG1-mediated effects from non-specific or secondary phenomena and ensure reproducibility of research findings.

How can researchers effectively study ABCG1 interactions with other proteins in the ABC transporter pathways?

Studying ABCG1 interactions with other proteins in ABC transporter pathways requires multiple complementary approaches:

  • Co-immunoprecipitation assays:

    • Using antibodies against endogenous ABCG1 or epitope-tagged versions

    • Reciprocal IP validation to confirm interactions

    • Use of crosslinking to stabilize transient interactions

  • Proximity labeling approaches:

    • BioID or APEX2 fusion to ABCG1 to identify proteins in close proximity

    • TurboID for faster labeling kinetics of interacting partners

  • Fluorescence-based interaction assays:

    • FRET/BRET to detect interactions in living cells

    • Split-GFP complementation to visualize interaction sites

  • Functional interaction studies:

    • Co-expression of ABCG1 with other ABC transporters

    • siRNA knockdown of potential partners followed by ABCG1 functional assays

    • Assessment of transport activity in reconstituted systems with defined components

  • Pathway analysis:

    • RNA-seq or proteomics to identify co-regulated genes/proteins

    • ChIP-seq to identify common transcriptional regulators

    • Metabolomics to assess functional consequences of interactions

The ABC transporter pathway involves multiple interacting proteins, including ABCD2, ABCD3A, ABCB4, ABCB7, ABCC2, ABCB1A, ABCB1LB, ABCC4, CFTR, and ABCC3 . These proteins may functionally complement or regulate ABCG1 activity, making their study crucial for understanding the integrated function of lipid transport pathways.

What are emerging technologies that may advance ABCG1 research?

Several cutting-edge technologies are poised to significantly advance ABCG1 research:

  • Cryo-electron microscopy (Cryo-EM):

    • Determination of high-resolution ABCG1 structures in different conformational states

    • Visualization of substrate binding and transport mechanisms

    • Structural basis for selective inhibitor design

  • CRISPR-based technologies:

    • Base editing for precise introduction of ABCG1 variants

    • CRISPRi/CRISPRa for temporal control of ABCG1 expression

    • CRISPR screens to identify regulators and interactors

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize ABCG1 clustering and membrane organization

    • Single-molecule tracking to observe transport dynamics in real-time

    • Correlative light and electron microscopy to link function to ultrastructure

  • Organoid and 3D culture systems:

    • Study of ABCG1 function in more physiologically relevant contexts

    • Tissue-specific effects in differentiated organoid models

    • Patient-derived systems to study variant effects

  • Systems biology approaches:

    • Multi-omics integration to place ABCG1 in broader cellular networks

    • Computational modeling of lipid transport kinetics

    • Machine learning to predict functional consequences of genetic variants

These technologies will enable researchers to address long-standing questions about ABCG1 function, regulation, and therapeutic targeting with unprecedented precision and physiological relevance.

What are the most significant unresolved questions about ABCG1 function and regulation?

Despite significant advances, several fundamental questions about ABCG1 remain unresolved:

  • Structural determinants of substrate specificity:

    • How does ABCG1 recognize and differentiate between various lipid substrates?

    • What structural features enable selective transport of oxysterols like 7beta-hydroxycholesterol?

  • Regulatory mechanisms:

    • How is ABCG1 activity acutely regulated in response to cellular lipid status?

    • What transcription factors beyond the known nuclear receptors control ABCG1 expression?

    • How do post-translational modifications collectively regulate ABCG1 function?

  • Tissue-specific functions:

    • Why do ABCG1 knockout mice show tissue-specific phenotypes?

    • What determines the relative importance of ABCG1 vs. other transporters in different tissues?

  • Disease relevance:

    • To what extent do ABCG1 genetic variants contribute to human disease risk?

    • How might ABCG1 be therapeutically targeted to treat metabolic disorders?

  • Mechanistic questions:

    • Does ABCG1 function primarily at the plasma membrane, or in intracellular compartments?

    • How does the ATP hydrolysis cycle couple to the physical movement of lipid substrates?

    • What is the stoichiometry of ATP hydrolysis to lipid transport?

Addressing these questions will require innovative approaches combining structural biology, advanced imaging, genetic manipulation, and physiological models. The integration of data across these disciplines represents the next frontier in ABCG1 research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.