Recombinant Human Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2)

Shipped with Ice Packs
In Stock

Description

Functional Characteristics

Substrate Specificity
ABCG2 transports:

  • Chemotherapeutic agents: Mitoxantrone, topotecan, gefitinib .

  • Endogenous compounds: Uric acid, heme, protoporphyrin IX .

  • Dietary toxins: Pheophorbide a, chlorophyll derivatives .

Functional AssayFindings
ATPase ActivityDrug-stimulated ATP hydrolysis confirmed in reconstituted yeast systems .
Transport EfficiencyReduced in mutants (e.g., M71V, Q141K) due to impaired membrane trafficking .
Inhibitor SensitivityReversed by Ko143, fumitremorgin C, and tyrosine kinase inhibitors .

Key Mutations

  • M71V: Reduces membrane expression but retains partial activity .

  • R482G: Enhances substrate promiscuity in recombinant studies .

Research Applications and Findings

Expression Systems
Recombinant ABCG2 has been synthesized in:

  1. Saccharomyces cerevisiae: Retains drug-stimulated ATPase activity post-purification .

  2. Wheat germ: Produces full-length protein for ELISA and Western blot .

  3. HEK 293 cells: Used for functional transport assays (e.g., Hoechst 33342 efflux) .

Mechanistic Studies

  • Valve-and-lid mechanism: The di-leucine motif controls substrate extrusion, while the EL3 roof acts as a gate .

  • Dynamic transmission interface: Salt bridges between ICL1 and the elbow helix coordinate ATP hydrolysis with substrate translocation .

Clinical and Pharmacological Relevance

  • Drug Resistance: Overexpression in cancer cells reduces intracellular drug accumulation .

  • Gout Pathogenesis: Impaired uric acid transport (e.g., Q141K mutation) elevates serum urate levels .

  • Milk Secretion: Mediates riboflavin and biotin export into breast milk .

Challenges and Future Directions

  • Expression Optimization: Yeast systems yield under-glycosylated protein, necessitating mammalian platforms for native-like post-translational modifications .

  • Therapeutic Targeting: Small molecules (e.g., E451D correctors) may rescue mutant ABCG2 function .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific requirements for the format, please indicate your needs when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are standardly shipped with regular blue ice packs. If you require shipping with dry ice, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% of glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ABCG2; ABCP; BCRP; BCRP1; MXR; Broad substrate specificity ATP-binding cassette transporter ABCG2; ATP-binding cassette sub-family G member 2; Breast cancer resistance protein; CDw338; Mitoxantrone resistance-associated protein; Placenta-specific ATP-binding cassette transporter; Urate exporter; CD antigen CD338
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-655
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MSSSNVEVFIPVSQGNTNGFPATASNDLKAFTEGAVLSFHNICYRVKLKSGFLPCRKPVE KEILSNINGIMKPGLNAILGPTGGGKSSLLDVLAARKDPSGLSGDVLINGAPRPANFKCN SGYVVQDDVVMGTLTVRENLQFSAALRLATTMTNHEKNERINRVIQELGLDKVADSKVGT QFIRGVSGGERKRTSIGMELITDPSILFLDEPTTGLDSSTANAVLLLLKRMSKQGRTIIF SIHQPRYSIFKLFDSLTLLASGRLMFHGPAQEALGYFESAGYHCEAYNNPADFFLDIING DSTAVALNREEDFKATEIIEPSKQDKPLIEKLAEIYVNSSFYKETKAELHQLSGGEKKKK ITVFKEISYTTSFCHQLRWVSKRSFKNLLGNPQASIAQIIVTVVLGLVIGAIYFGLKNDS TGIQNRAGVLFFLTTNQCFSSVSAVELFVVEKKLFIHEYISGYYRVSSYFLGKLLSDLLP MRMLPSIIFTCIVYFMLGLKPKADAFFVMMFTLMMVAYSASSMALAIAAGQSVVSVATLL MTICFVFMMIFSGLLVNLTTIASWLSWLQYFSIPRYGFTALQHNEFLGQNFCPGLNATGN NPCNYATCTGEEYLVKQGIDLSPWGLWKNHVALACMIVIFLTIAYLKLLFLKKYS
Uniprot No.

Target Background

Function
Broad substrate specificity ATP-dependent transporter belonging to the ATP-binding cassette (ABC) family. This transporter actively removes a wide range of physiological compounds, dietary toxins, and xenobiotics from cells. It plays a crucial role in porphyrin homeostasis, mediating the export of protoporphyrin IX (PPIX) from both mitochondria to cytosol and cytosol to the extracellular space. Additionally, it participates in the cellular export of heme. It also mediates the efflux of sphingosine-1-P from cells. ABCG2 acts as a urate exporter, contributing to both renal and extrarenal urate excretion. In the kidney, it functions as a physiological exporter of the uremic toxin indoxyl sulfate. Furthermore, it is involved in the excretion of steroids such as estrone 3-sulfate/E1S, 3beta-sulfooxy-androst-5-en-17-one/DHEAS, and other sulfate conjugates. This transporter mediates the secretion of riboflavin and biotin vitamins into milk. It extrudes pheophorbide a, a phototoxic porphyrin catabolite of chlorophyll, reducing its bioavailability. ABCG2 plays a significant role in the exclusion of xenobiotics from the brain (probable). It confers resistance to cells against multiple drugs and other xenobiotics including mitoxantrone, pheophorbide, camptothecin, methotrexate, azidothymidine, and the anthracyclines daunorubicin and doxorubicin, by regulating their efflux. In the placenta, it limits the penetration of drugs from maternal plasma into the fetus. ABCG2 might play a role in early stem cell self-renewal by inhibiting differentiation.
Gene References Into Functions
  1. The BCRP knocked-down resulted in a significant reduction in excretion rates of CICT-3-G, while MRP1 and MRP4-mediated silencing led to a marked decrease in the excretion of CICT-3-G PMID: 30237061
  2. The SNP loci rs2725220 and rs2231137 of the ABCG2 gene, but not rs2231142, showed significant differences between patients with non-phlegm block and phlegm block. In Han and hyperuricemia patients, the rs2725220 allele G was a protective factor, and the rs2231137 allele C was a risk factor. ABCG2 gene rs2231137 with more allele C tends to be phlegm-block type, and rs2725220 with more allele G tends to be non-phlegm-block type. PMID: 30197413
  3. This article provided a comprehensive review of Single Nucleotide Polymorphisms of ABCG2 in clinical relevance concerning gout, acute myeloid leukemia, solid tumors, and other diseases. [review] PMID: 29964015
  4. BCRP is expressed on the erythrocyte membrane. PMID: 29098941
  5. High ABCG2 expression is associated with oxidative stress in colorectal cancer. PMID: 30066914
  6. MiR-655-3p showed a 6.79-fold decrease in expression after 12 h exposure compared to 0 h, was predicted in silico to bind ABCG2 3'-UTR and showed a significant negative correlation (p = 0.01) to ABCG2 expression level. PMID: 28990842
  7. High ABCG2 expression in esophageal cancer tissues is implicated in the multidrug resistance of esophageal cancer PMID: 30104076
  8. High ABCG2 expression is linked to chemotherapeutic resistance in gastric cancer. PMID: 30106453
  9. The interindividual regulation of BCRP expression. PMID: 29386232
  10. PBPK model analysis enabled quantitative evaluation of alterations in BCRP activity. PMID: 29440178
  11. Pantoprazole can be used to assess the impact of BCRP on gastrointestinal absorption in nonrodent models. PMID: 29358184
  12. These SNPs could contribute to patient-level variation in ABCG2 expression in the kidney, liver, and intestine. PMID: 29467213
  13. The current study suggests that high incidence rates of hyperuricemia in the Chinese population of the southeast coastal region may be closely associated with variants of ABCG2rs2231142. PMID: 30015934
  14. 13-cis-retinoic acid, retinol, and retinyl-acetate inhibited the Pgp and ABCG2 mediated substrate transport as well as the substrate stimulated ATPase activity of these transporters. PMID: 28145501
  15. Genotyping of the ABCG2 gene using Matrix-Associated Laser Desorption/Ionisation, Time-of-Flight Mass Spectrometry PMID: 28940904
  16. The effect of BCRP should be carefully evaluated in pancreatic cell lines that highly express BCRP. PMID: 29246888
  17. Results showed that the expression of IGF1R appears to be highly correlated with the expression of ABCG2 in osteosarcoma and with the expression of CD44 in osteosarcoma patients under the age of 10. PMID: 29892839
  18. Results indicate that the transmembrane region of ABCG2 is sensitive to amino acid substitution, and patients carrying these ABCG2 variant forms could experience unexpected pharmacokinetic events of ABCG2 substrate drugs or have an increased risk for diseases such as gout where ABCG2 is implicated PMID: 28281205
  19. There were no significant differences in the bosutinib C0 between genotypes for ABCB1, ABCG2, and CYP3A4 polymorphisms. PMID: 29736778
  20. FOXM1 and ABCG2 might be useful targets and important parameters in the treatment of bladder cancer. PMID: 29397866
  21. High ABCG2 expression is associated with drug resistance in Breast Cancer. PMID: 29286612
  22. BCRP is differentially expressed in AT2 and AT1-like cells with lower abundance and activity in the latter ones. Nuclear BCRP might play a transcriptional role in distal lung epithelium. In NCI-H441 cells, BCRP is expressed in apical cell membranes, and its activity is consistent with the localization pattern. PMID: 28470471
  23. Patients prescribed with short-term low-dose atorvastatin and carrying ABCB1 (rs1128503) or ABCG2 (rs2231142) SNPs did not show differences in LDL-C response (P>.05). PMID: 28833323
  24. Combined exposure to the four high-risk genotypes of ALPK1 and the uric-acid-related loci of ABCG2, SLC2A9, and SLC22A12 was associated with an increased gout risk and a high PPV for gout. PMID: 29215084
  25. The International Transporter Consortium has identified ABCG2 as a pharmacogene with clinically important polymorphisms. Here, we describe the role of ABCG2 in efflux transport and highlight its pharmacogenetic relationships. PMID: 28858993
  26. None of the genotypes in ABCB1 1236 C>T, 2677 G>T/A, 3435 C>T, and 4036 A>G correlated with plasma dolutegravir concentration. The speculated peak level of plasma dolutegravir concentration was significantly higher in ABCG2 genetic variant holders, probably, at least in part, because of low expression levels of efflux transporters in the intestines associated with these genetic variants. PMID: 28858994
  27. Ultrasound reverses chemoresistance in breast cancer stem cell-like cells by reducing ABCG2 expression. PMID: 28935760
  28. ABCG2 plays a significant role in the resistance of A172 glioma cell line to methyl ester pyropheophorbide-a-mediated photodynamic therapy. PMID: 28370217
  29. Circulating intestine-derived exosomal miR-328 in plasma has potential as a possible biomarker for estimating breast cancer resistance protein (BCRP) function in the intestines. PMID: 27571936
  30. SLCO1B1 and ABCG2 polymorphisms are better predictors of rosuvastatin exposure than ethnicity alone and could be considered in precision medicine dosing of rosuvastatin. PMID: 28385543
  31. The rs2054576 in ABCG2 is associated with hyperuricemia susceptible loci that passed a genome-wide significance threshold, adjusted by clinical variables (male, age, BMI, current alcohol, and creatinine). PMID: 28776340
  32. These findings demonstrate for the first time ABCG2-mediated intestinal urate excretion in humans and indicate the physiological and pathophysiological importance of intestinal epithelium as an excretion pathway besides an absorption pathway. PMID: 27571712
  33. Our data confirm a negative impact of ABCG2 and CD200 overexpression also in AML patients considered at favorable risk according to ELN cytogenetic/molecular classification. PMID: 28618016
  34. The high expressions of BCRP mRNA calculated with Pfaffl's rule and FLT3-ITD are independent poor risk factors in adult patients with AML and intermediate or normal karyotype. PMID: 28618074
  35. role of GLI2-ABCG2 signaling axis for 5Fu resistance in gastric cancer PMID: 28847472
  36. These results indicate that ABCG2 421A/A and CYP3A5*3 genotypes and renal function are considered potential factors affecting trough concentrations of apixaban. PMID: 28678049
  37. Posttranscriptional regulation of HuR by miR-133b enhances DTX cytotoxicity through inhibition of ABCG2. PMID: 29327946
  38. ABCG2+ cells in PDAC in adherent culture are not correlated with stemness and malignant behaviors. PMID: 29444383
  39. Cholesterol may play a critical role in the post-translational regulation of BCRP in placental lipid rafts. PMID: 28623970
  40. Study shows that ABCG2 can actively drive expression of stem cell markers and self-renewal in glioma cells but did not affect radiation resistance or tumorigenicity in vivo. These results highlight ABCG2 as a potential driver of glioma stemness. PMID: 27456282
  41. Several members of a Turkish family with the index individual diagnosed with an alloanti-Jra were studied. Sequencing all exons of the ABCG2 gene revealed a homozygous C-to-T exchange in Exon 4 at Position c.439 in exon 4 in 3 members and heterozygosity in a 4th. PMID: 29106709
  42. Erythrocytes from a pregnant Pakistani woman and her 2 male siblings were typed for 2 mutations in the ABCG2 gene. Both mutations lead to a frameshift and premature stop codon, which are predicted to cause absence of the protein. Sibling 1 had the same two changes in ABCG2 that were identified in the propositus (c.420_421insA and c.986_987delTA), and Sibling 2 had only the c.986_987delTA change. The woman had both. PMID: 28836283
  43. The ABCB1 promoter was more frequently methylated in tumor tissues than in tumor-adjacent and tumor-distant tissues, whereas for the ABCG2 promoter, no difference was found between the three tissue specimens. PMID: 27689338
  44. Our study describes the relationship between ABCG2 and OCT-4 expression and the clinicopathological characteristics of RCC patients. ABCG2 and OCT-4 expression was significantly correlated with RCC recurrence, which has a poor prognosis. PMID: 28212529
  45. The study identifies SNPs within regulatory regions of the ABCG2 locus that alter enhancer activity in vitro and in vivo. Several of these SNPs correlate with tissue-specific ABCG2 expression and alter DNA/protein binding. These SNPs could contribute towards reported tissue-specific variability in ABCG2 expression and may influence the correlation between ABCG2 expression and disease risk or the pharmacokinetics and pharmacody PMID: 28930109
  46. Genetic association studies in population in China: Data suggest that SNPs in SLC2A9 (rs11722228, rs3775948) and ABCG2 (rs2231142) are associated with diabetic kidney disease in subjects with type 2 diabetes in the population studied. (SLC2A9 = solute carrier family 2 member 9; ABCG2 = ATP binding cassette subfamily G member 2) PMID: 26993665
  47. Study validated that ABCG2 was up-regulated in gastric cancer (GC) tissues and cells. The higher level of ABCG2 expression in GC cells was correlated with advanced stages of GC involved with poor prognosis. ABCG2 was a GC promoter affecting cell proliferation and inducing cell apoptosis resistance. PMID: 28029654
  48. Results found ABCG2 overexpressed in lung cancer side population cells. Its expression is regulated YAP1 at the transcriptional level through binding to its promoter region. PMID: 27911857
  49. Interestingly and in contrast with our expectation, we found that the expression level of FBLN-4 and BCRP were downregulated in tumor compared to adjacent normal tissues. FBLN-4 was associated with grade histology and therefore can be considered as a potential prognostic biomarker. PMID: 28282800
  50. Allogeneic SCT does not seem to abrogate the negative prognosis associated with ABCG2 overexpression at diagnosis, specifically in terms of a higher relapse risk PMID: 27178373

Show More

Hide All

Database Links

HGNC: 74

OMIM: 138900

KEGG: hsa:9429

STRING: 9606.ENSP00000237612

UniGene: Hs.480218

Protein Families
ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Apical cell membrane; Multi-pass membrane protein. Mitochondrion membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in placenta. Low expression in small intestine, liver and colon. Expressed in brain (at protein level).

Q&A

What is the basic structural organization of ABCG2?

ABCG2 is a half transporter that functions as a homodimer or oligomer. Each monomer contains a highly conserved nucleotide binding domain (NBD) connected to a transmembrane domain (TMD). Unlike other ABC transporters, ABCG2 exhibits a unique fold revealed by recent structural studies. The minimal functional unit requires two NBDs that hydrolyze ATP to power substrate transport through the membrane. The ABCG2 architecture features several key elements including an elbow helix, the first intracellular loop (ICL1), and the NBD, which collectively form a transmission interface bordering a central cavity that functions as a drug trap .

How does the valve mechanism control substrate transport in ABCG2?

The ABCG2 transporter contains a hydrophobic di-leucine motif (L554 and L555) in its core that functions as a valve to control drug extrusion. This valve separates a large intracellular cavity from a smaller upper cavity. Experimental evidence shows that while L554 is not essential for ABCG2 function, position L555 requires a large hydrophobic residue for proper protein folding and drug movement to the upper cavity. Mutation studies demonstrate that reducing the side chain size at position 555 (e.g., L555C and L555A mutants) severely diminishes protein levels due to reduced stability, while maintaining the hydrophobic nature with L555I preserves transport function .

What is known about the extracellular architecture of ABCG2?

The extracellular structure of ABCG2 forms a distinctive "roof" architecture above the upper cavity, involving the re-entry helix and all extracellular loops. This roof structure is stabilized by at least two intra-molecular disulfide bonds (connecting C592 and C608), an intermolecular disulfide bond (linking C603 in each monomer), and a salt bridge between R426 of ECL1 and E585 of the re-entry helix. These structural elements limit roof flexibility while providing a lid-like function to control drug release. Mutation studies show that disrupting the salt bridge (R426E or E585R mutations) completely abolishes ABCG2 maturation .

How does ABCG2 utilize a peristaltic pump-like mechanism for drug transport?

ABCG2 appears to operate similar to a peristaltic pump rather than following the classical alternating access mechanism of other ABC transporters. Based on structural and functional studies, drug translocation from the central to the upper cavity occurs through the valve and is driven by a squeezing motion. The TMH1 and TMH2 helices provide a key mechanical link for the cross-talk that drives conformational switching during drug translocation. Unlike other ABC transporters that require widely separated intracellular parts, ABCG2 likely uses subtle repositioning and rotation of transmembrane helices to facilitate transport, with conformational changes involving less dramatic movements than previously thought .

What are the key residues involved in substrate specificity of ABCG2?

The R482 position plays a critical role in determining the substrate specificity of ABCG2. Molecular dynamics simulations show that the R482G variation alters the orientation of transmembrane helices. In silico docking calculations have identified that the R482 position is located in one of the substrate binding pockets. The R482G variant affects both substrate specificity by influencing the drug binding pocket (Site 2) and alters cholesterol regulation through allosteric communication via TH1 to the CRAC motif (Y413). Other residues potentially significant in cholesterol modulation include Y413 and amino acids 555–558 .

How does the Q141K polymorphism impact ABCG2 structure and function?

The Q141K variant, which is the most frequent polymorphism of ABCG2, exhibits decreased functional expression resulting in increased drug accumulation and decreased urate secretion. Molecular dynamics simulations reveal that in the Q141K variant, the introduced positive charge diminishes the interaction between the nucleotide binding and transmembrane domains. The Q141 position is located deep in the structure at the interface between domains, and its mutation affects the stability of the protein rather than directly altering substrate binding. This variant is clinically significant as it is linked to gout and altered drug responses .

What methods are effective for studying ABCG2 transport function?

To assess ABCG2 transport function, researchers commonly employ fluorescent substrate efflux assays using compounds like mitoxantrone. Efflux activity is measured by flow cytometry, comparing substrate accumulation in the presence and absence of specific ABCG2 inhibitors. For mechanistic studies, ATPase activity assays are crucial to connect substrate transport with ATP hydrolysis. These functional tests should be coupled with assessment of protein expression levels and membrane localization using techniques such as western blotting and confocal microscopy. When testing mutant variants, it's essential to normalize transport activity to surface expression levels to distinguish between expression and functional defects .

How can researchers generate reliable homology models of ABCG2?

For generating reliable ABCG2 homology models, the ABCG5-ABCG8 heterodimer structure provides an excellent template, with ABCG2 exhibiting 27% and 26% identities and 48% and 44% similarities to ABCG5 and ABCG8, respectively. Sequence alignment should recognize that some parts of ABCG2 may not be modeled due to mobility or differences from the template. The stability of the model should be validated through molecular dynamics simulations of the ABCG2 homodimer embedded in a membrane bilayer. Monitoring RMSD values of frames compared to the initial structure can indicate model stability. The model should be further validated by correlating with experimental observations from mutation studies and functional assays .

What techniques can be used to identify substrate binding sites in ABCG2?

To identify substrate binding sites in ABCG2, researchers can employ a multi-faceted approach:

  • In silico docking calculations using multiple equilibrated conformations of the protein

  • Site-directed mutagenesis of predicted binding pocket residues

  • Photoaffinity labeling with substrate analogs

  • Competition assays between different substrates

  • Assessment of ATPase activity modulation by substrates

Research has shown that even subtle conformational changes (with maximum RMSD between equilibrated structures of 1.3 Å) are sufficient to provide binding sites at different regions of the protein. Multiple binding sites have been identified, suggesting that ABCG2 can accommodate various substrates through different binding pockets .

How is ABCG2 expression regulated in stem cells?

ABCG2 expression in stem cells is regulated through multiple mechanisms, with microRNA interference playing a significant role. Expression of miR-519c and miR-520h is inversely correlated with ABCG2 protein levels in human embryonic stem cell (hESC) lines. During BMP-4-mediated differentiation, a 9.2-fold reduction in both miRNAs corresponds to increased ABCG2 protein expression. Experimental validation through transfection of inhibitors of miR-519c and miR-520h modulates ABCG2 protein expression, while introduction of the corresponding mimics decreases ABCG2 protein expression. This miRNA-mediated regulation appears to be a key post-transcriptional mechanism controlling ABCG2 levels in stem cells .

What methodological approaches are recommended for analyzing ABCG2 genetic variation?

For comprehensive analysis of ABCG2 genetic variation, researchers should consider a multi-step approach:

  • High-Resolution Melting (HRM) analysis for initial scanning of the ABCG2 coding sequence

  • Verification of scanning results by DNA sequencing

  • Genotyping of specific polymorphisms using appropriate techniques

  • Inter-population comparison of polymorphism frequencies

  • Prediction of functional effects of missense variants using in silico tools

  • Linkage disequilibrium and haplotype blocks analysis using parameters like r² and D'

For population studies, it's important to compare findings with available population statistics using tools like the LDmatrix Tool from the LDlink package. Strong linkage has been observed between certain SNPs, such as c.34G>A (p.Val12Met) and c.203+36A>G (r²= 0.852), providing insights into the genetic architecture of ABCG2 variation .

How does ABCG2 contribute to anticancer drug resistance mechanisms?

ABCG2 contributes to anticancer drug resistance through its function as an efflux pump that actively extrudes various anticancer agents from cells. In cancer cells, ABCG2 overexpression leads to decreased intracellular drug accumulation, thereby reducing drug efficacy. Research has identified specific regions of ABCG2 that could be targeted to overcome this resistance. The valve mechanism (particularly the L555 residue) and essential residues in the roof structure offer potential therapeutic targets. When designing inhibitors, researchers should consider the unique structural features of ABCG2, including the central cavity drug trap and the valve-controlled substrate translocation pathway .

What experimental models are most appropriate for studying ABCG2-mediated transport in different tissues?

For studying ABCG2-mediated transport in different tissues, researchers should select models that recapitulate the physiological context:

Tissue/BarrierRecommended Model SystemsKey Considerations
Blood-Brain BarrierPrimary brain endothelial cells, hCMEC/D3 cell line, in vivo rodent modelsExpression levels comparable to human BBB, functional assays with CNS drugs
Placental BarrierBeWo and JAR choriocarcinoma cell lines, ex vivo placental perfusion, primary trophoblastsDifferentiation stage impacts expression, hormonal regulation
Intestinal BarrierCaco-2 cell monolayers, organoids, in vivo modelsCell polarization critical, regional expression differences
Cancer ModelsPatient-derived xenografts, resistant cell lines, 3D spheroidsConsider tumor microenvironment effects on expression
Stem CellsiPSCs, side population assays, embryonic stem cellsDevelopmental stage affects expression patterns

For all models, validation of ABCG2 expression levels and transport activity compared to human tissues is essential. Heterologous expression systems like HEK293 cells are valuable for mechanistic studies of specific mutations but may not fully replicate tissue-specific regulation .

How should researchers address contradictory results in ABCG2 studies using stem cells?

Contradictory results in ABCG2 studies using human embryonic stem cells (hESCs) can stem from different cellular states, suboptimal growth conditions, and differential handling of hESCs. To address these challenges, researchers should:

  • Standardize culture conditions and clearly report all parameters

  • Characterize the pluripotency state of cells using multiple markers

  • Monitor ABCG2 expression at both mRNA and protein levels

  • Consider the impact of passage number on ABCG2 expression

  • Account for the influence of specific miRNAs that regulate ABCG2

  • Validate findings across multiple hESC lines

  • Use isogenic systems when comparing effects of differentiation

Research has shown that different hESC lines (e.g., WA09 and WA01) can exhibit varying responses to the same treatment conditions, including different patterns of miRNA expression that regulate ABCG2. These differences should be systematically documented and considered when interpreting seemingly contradictory results .

What approaches are recommended for analyzing the impact of novel ABCG2 mutations?

When analyzing novel ABCG2 mutations, researchers should implement a comprehensive approach:

  • Structural context assessment: Map the mutation onto the ABCG2 homology model to understand its location relative to functional domains (NBDs, TMDs, valve region, roof structure)

  • In silico prediction: Use multiple prediction tools to assess potential functional impact

  • Expression system validation: Test the mutation in heterologous expression systems, measuring:

    • Total protein expression

    • Membrane localization

    • Glycosylation status

    • Protein stability

  • Functional characterization:

    • Transport assays with multiple substrates

    • ATPase activity measurements

    • Drug binding studies

  • Dynamic analysis: Consider molecular dynamics simulations to understand how the mutation affects:

    • Protein flexibility

    • Domain interactions

    • Conformational changes

Research has shown that ABCG2 is highly sensitive to mutations, and its cysteine-less form cannot be functionally expressed. When interpreting results, it's important to distinguish between effects on protein biogenesis/stability versus direct functional impacts on transport activity or substrate specificity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.